Analysis Date2013-11-22 17:25:34
MD5148f27569052190639198d9f6f0b0060
SHA141ba9577ad57b7b0bb9ad92f7a4d4afca8b7e266

Static Details:

File typePE32 executable for MS Windows (GUI) Intel 80386 32-bit
Section.text md5: 7ff5fed548868ed7902c096c0264aa05 sha1: 1a75a9b0500a1735878c36f3b6bd0f6b84acbfd6 size: 26624
Section.rdata md5: 161b329b4c70ce4fbd9c1143e738896b sha1: e08fa356a7aa0040d1da68b8c9850ce54da2371c size: 6656
Section.data md5: 140876ba314e7bc36379ee5c6db80876 sha1: a2ea157dd321d7f51b80aba4e82c27755871d6c0 size: 512
Section.ndata md5: d41d8cd98f00b204e9800998ecf8427e sha1: da39a3ee5e6b4b0d3255bfef95601890afd80709 size: 0
Section.rsrc md5: 088ebdabb3997b631fb8458a84ccffa1 sha1: 999b9bcd5949b96b197cae1a1494a15f053292e1 size: 81920
Timestamp2010-04-10 12:19:38
VersionLegalCopyright: Copyright (C) 2004-2012
InternalName: DAEMON Tools Lite4.47.1.0333.exe
FileVersion: 4.47.1.0333.0
CompanyName: Disc Soft Ltd
ProductName: DAEMON Tools Lite
ProductVersion: 4.47.1.0333.0
FileDescription: DAEMON Tools Lite Setup
OriginalFilename: DAEMON Tools Lite4.47.1.0333.exe
PEhash1fd98761d8508b352113e5488560e3bea1dac36b
AVavgWin32/Sality
AVaviraW32/Sality.AT
AVmcafeeW32/Sality.gen.z
AVmsseVirus:Win32/Sality.AT

Runtime Details:

Screenshot

Process
↳ C:\malware.exe

RegistryHKEY_CURRENT_USER\Software\Aasppapmmxkvs\A1_0 ➝
1126387021
RegistryHKEY_LOCAL_MACHINE\Software\Microsoft\Windows\CurrentVersion\policies\system\EnableLUA ➝
NULL
RegistryHKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Security Center\Svc\AntiVirusOverride ➝
1
RegistryHKEY_CURRENT_USER\SOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\Advanced\Hidden ➝
2
RegistryHKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\SharedAccess\Parameters\FirewallPolicy\StandardProfile\EnableFirewall ➝
NULL
RegistryHKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\SharedAccess\Parameters\FirewallPolicy\StandardProfile\AuthorizedApplications\List\C:\malware.exe ➝
C:\malware.exe:*:Enabled:ipsec
RegistryHKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Security Center\AntiVirusOverride ➝
1
RegistryHKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\GlobalUserOffline ➝
NULL
RegistryHKEY_CURRENT_USER\Software\Aasppapmmxkvs\-993627007\1768776769 ➝
144
Creates FileC:\Documents and Settings\Administrator\Local Settings\Temp\~nsu.tmp\Au_.exe
Creates FileC:\WINDOWS\SYSTEM.INI
Creates FilePIPE\SfcApi
Creates FileC:\Program Files\Adobe\Acrobat 7.0\Reader\AcroRd32.exe
Creates FilePIPE\lsarpc
Creates FileC:\TEMP\monitor.exe
Creates File\Device\Afd\Endpoint
Creates FileC:\Documents and Settings\Administrator\Local Settings\Temp\00014D6F_Rar\malware.exe
Deletes FileC:\Documents and Settings\Administrator\Local Settings\Temp\nsw1.tmp
Creates Process"C:\Documents and Settings\Administrator\Local Settings\Temp\~nsu.tmp\Au_.exe" _?=C:\
Creates MutexuxJLpe1m
Creates Mutexservices.exeM_616_
Creates Mutexsvchost.exeM_1028_
Creates Mutexsvchost.exeM_1116_
Creates Mutexspoolsv.exeM_1320_
Creates Mutexcsrss.exeM_548_
Creates Mutexsvchost.exeM_860_
Creates Mutexlsass.exeM_628_
Creates Mutexsmss.exeM_500_
Creates Mutexuserinit.exeM_252_
Creates Mutexalg.exeM_1864_
Creates Mutexwinlogon.exeM_572_
Creates Mutexsvchost.exeM_796_
Creates Mutexexplorer.exeM_352_
Creates Mutexsvchost.exeM_1216_

Process
↳ "C:\Documents and Settings\Administrator\Local Settings\Temp\~nsu.tmp\Au_.exe" _?=C:\

Creates FileC:\Documents and Settings\Administrator\Local Settings\Temp\000198D0_Rar\Au_.exe
Deletes FileC:\Documents and Settings\Administrator\Local Settings\Temp\nsq2.tmp
Creates MutexuxJLpe1m

Process
↳ C:\WINDOWS\Explorer.EXE

Network Details:


Raw Pcap

Strings
< & 
 _?=
*?|<>/":
****************************************************************************
\*.*
,0,0)
00000409
000004b0
0.1.0.16
040904e4
041904b0
0Are you sure you want to remove selected server?
0Unable to burn UDF file system to not empty disc
0x00000001
0x000C
0x000F0000
0x0030
0x05010000
0x40000000
0x7FFFFFFF
0x80000000
0xFFFF
1.0.0.0001
10033
10036
10037
10038
10039
10040
10041
10044
10118
1028
1034
1035
1037
1038
1039
1045
1201
1202
1203
1204
1256
16 bytes of PQ
!1Aa
1 drive
 2000-2012 DT Soft Ltd.
 2000-2013 Disc Soft Ltd.
2Blocked License.
2 drives
#32770
333f3
#+3;CScs
3 drives
3Select image you want to make accessible via iSCSI:
3You set an empty password. Do you wish to continue?0The file is read only. Failed to save this file.
4.47.1.0333
4.47.1.0333.0
4488
4 drives
4You can share only 2 devices at once in beta version=You can connect only to one remote usb device in beta version
5To add IDE device SPTD has to be installed. Continue?'DAEMON Tools Net Service is not running
5You already have the maximum number of iSCSI Targets.
\7F4987FB1A6E43d69E3E94B29EB75926
8361
	8+3 names
96 bytes of raw PW
9Folder doesn't exist or invalid folder name is specified.(Folder should be empty to mount a drive.-DVD region should be in the range from 0 to 8
-a. 
A506C90E-88E7-49be-9A4B-30A4E2185EBC
Aangepast
Abaikan untuk meloncati berkas ini.
Abbrechen
 a bien 
Abort
- abort() has been called
About
About...
Accept >
Access denied.
Access is denied..Item with this name already exists in catalog.)Failed to create image storage directory.
Aceast
Action
&Actions
Activate
Activation checking error.4All %s virtual drives will be removed. Are you sure?
Activation failed
Activation period expired.
Active Clients: %d of %d
Active connections:
Active Connections
Add all Please add images for converting
Add &Client Instance...
Add computer...
Add &Data Server Instance...
Add Device
Add file
Add Files...
Add Images...
Adding filesQAn entry's name cannot contain any of the following characters: / \ : * ? " < > |#Item with this name already exists.1Are you sure you want to delete selected item(s)?.Are you sure you want to delete selected item?
Adding server...
Adding virtual device
Add instance
Add iSCSI Server
Add iSCSI Target
Additional options:
"Add new %s virtual drive and mount
Add new virtual drive and mount%Add new virtual drive and mount image)Failed to open DAEMON Tools Image Catalog
Add/remove buttons
Add server
Add Server...:The application activation was rejected by License Server.
*Adds icon to your desktop for easy access.
Add %s Virtual Drive
Add target
Add to Catalog
Add to Image Catalog
Add to Image Catalog...*Image file already exist in image catalog.
Add to project
&Add Virtual Drive
Add Virtual Drive
Administrator's login name:
Administrator's password:
 adres
Advanced
Advanced Edition
Advanced emulation&SPTD driver with classic use interface
Advanced emulation UI
ADVANCED OPTIONS
advapi32
advapi32.dll
Advapi32.dll
 afinstallation
 afinstallations guiden
&Afinstaller
Afinstallerer
A folytat
 a fost dezinstalat de pe computerul dvs.
&Afsluiten
<A HREF="%s">Download Center</A> and install?|Astroburn Wizard can't launch without .NET Framework 4.0 installed.
<A HREF="%s">official site</A> and install?
&Aizv
aj da zapre
aj ili
aj ponovo za ponovni poku
ajte da 
 ajudada de desinstal
akajte ko se 
Alcohol virtual device
. Ali 
Alias
ali ili
alinama
alinim
alinimas
alinimo vedl
alinimo vedlys
alinta.
alinta i
alinti
All	Activated
All available Instances are already being used for this license.
	All files
All Files|*.*
All images
All images	Device %d
All images types
Alloc
All Options OFF
All Options ON
All rights reserved.
All supported images
Already Installed
Already used:
Always show full menus!Show full menus after short delay
Amosar &detalles
ana neizdev
anas vedn
A new version is available:
Animate menu when expanding
Annuler
Annuleren
Annuller
Anpassad
ant 
< &Anterior
anu.
Anuluj
An unknown error occurred trying to verify the signature of the "%s" file.
. Apakah anda ingin mereboot sekarang?
APE audio image*APE format is used only for Audio CD discs
APE images
 aplica
Application port:
Application type
Apply
Applying new settings...
april
April
 ara
*Are you sure you want to burn these files?
$Are you sure you want to clear tree?
#Are you sure you want to update %s?
Are you sure you wish to exit?;Please finish or cancel disc imaging operation before exit.
. Ar j
arobljak za deinstalaciju 
arobnjak
arobnjak 
arobnjak.
arobnjaka?
arobnjaka za uklanjanje
arobnjaka za uklanjanje 
arobnjak za deinstalaciju 
arobnjak za uklanjanje
arovnik
arovnika.
arovniku za odstranitev
arovnik vas bo vodil skozi odstranitev 
Arrange Icons
Arrange Images
Artist
Artist:	Non-empty
artlar
 asennuksen poisto
 asennusohjelma
 asennusohjelma opastaa sinua poistettaessa 
Asennus poistetaan
,Ask confirmation when turning on CD-R hiding2Save current positions as preferred layout on exit
 a slu
Assign	Reset All
as Starpliktuv
Astroburn Audio
Astroburn files Do you want to save the project?,Do you want to save the project before exit?
 Astroburn Lite 
Astroburn Lite
Astroburn Lite is not installedhDo you want to download Astroburn Lite software from product
Astroburn Pro
 Astroburns Lite 
-a s Va
Atcelt
ate ponovo, ili
< &Atgal
 Atiestat
 atinstal
 Atinstal
&Atinstal
ation de : 
 atlamak i
 atmint
< &Atpaka
< &Atr
 a trav
attached
attached to
Attaching media priority:1License activation is required for product usage.
Attach to Info Panel%Corresponding CUE file was not found.0Are you sure you want to clear image info cache?
Attach to physical device
- Attempt to initialize the CRT more than once.
- Attempt to use MSIL code from this assembly during native code initialization
 attraverso la disinstallazione di 
Audio
Audio CD
 Audio CD with graphics in RAW96.%Audio and Data tracks in one session.<Audio tracks in first session and data in all next sessions.%Unprotected Video CD/ Super-Video CD.
August
august	september
aukti
Ausf
auth
Authentication Dialog
Auto insert notification
Automatically check for update
Autorun
Auto Scroll&Close this window on successful finish
Autostart tray icon
autoupdate
Auto update
Available Modes
Available space
avam 
avanje
avanje:
avanje uklanjanja 
&Avanti >
Avbryt
Average Speed:
Avinstallasjon av 
 Avinstallation
 avinstallations guide
A&vinstaller
&Avinstallera
Avinstallerar
 avinstalleras.
Avinstallerer
A(z) 
(&B)
back
Back
< &Back
BackButtonText
BackEnabled
Background mode
bad ECC/EDC block
baigiamas 
baigiant 
Baigti
&Baigti
&Basic
Batal
bb >
bb gombra.
bb szeretn
because every recordable media like CD-R/RW or DVD-R/RW etc. will look like
&Befejez
Befejezve
&Begin a Group
Bem vindo ao Assistente de Desinstala
Benutzerdefiniert
Benvenuti al Wizard di Disinstallazione di 
Benvido ao asistente de desinstalaci
Benvingut a la guia de desinstal
&Berikut >
berspringen.
&Bez
Bienvenido al Asistente de Desinstalaci
Bienvenue dans l'assistant de d
 bilgisayar
Bine a
BITMAP
 blev afinstalleret fra din computer.
BlindRead Image (*.bwt)
BlindRead images
BlindWrite images
 blir avinstallert.
 bliver afinstalleret.
bne og skrive til filen:
 bol odin
Bootable disc
Boot Image
Boot Parameters
Boot Parameters...
boru
boru.
boru pre zapisovanie: 
Bottom
BOTTOM
Bottom=193
bowa
Brief Media Info
B&rowse...
Browsing
BThere are only empty folders for burning. Do you want to continue?
Buatan
Bu dosyay
Buffer size:
Buffer status: 
Buffer underrun protection
Burn
Burn Audio Disc
Burn Audio Disc...
BURN AUDIO DISC
Burn Data Disc
Burn Data Disc...
BURN DATA DISC
Burn Image
Burn Image...
BURN IMAGE	COPY DISC
Burn image on disc
Burn Image to Disc
Burn Image to Disc...
Burn Image with AstroburngAstroburn is not installed. Do you want to download Astroburn Lite software from product official site?
Burning
Burning Audio Disc
Burning Data Disc
Burning Image
Burn Project
Burn Project...
Burn Project to Disc
Burn Protected Disc
Burn Protected Disc...
Burn RMPS data
Burn to Disc...
Burn your image to disc
Burn your own data on disc Protect your data using password
Bu sihirbaz
Bu sihirbaz, 
 bus pa
busy
But if in case of problems with some applications, first of all, try to disable it.
BUTTON
Buy &Client
Buy &Data Server
Buy Now
&Buy Now...2Operation failed. Unable to save destination file.7Selected file type cannot be added to Audio CD project.
BuyURL
By installing this application, you agree to the Google Chrome <a href="%s">Terms of use</a> and <a href="%s">Privacy Policy</a>$Include Google Chrome, along with %s%Make Google Chrome my default browser
By installing this application you agree to the Google Toolbar <a href="%s">Terms and Conditions</a> and the <a href="%s">Privacy Policy</a>.
 byl odinstalov
by Seznam.cz
bytes
Byt namn:
(&C)
Call
callback%d
cancel
Cancel
Cancelar
CancelButtonText
canceled
CancelEnabled
Cancella
Cancelling...
Cancelling(Are you sure you want to erase the disc?
CancelShow
Cannot copy files for deploy.,Failed to register DAEMON Tools Net Service.)Failed to start DAEMON Tools Net Service.%Authentication failed. Cannot access.
Cannot create directory.
Cannot create file
Cannot delete image file.
Cannot get speeds.
Cannot get write speed.
.Cannot install the application on host system.
Cannot open device exclusively.tImage with the same path already exists in the Image Catalog folder %s. The old image will be deleted. Are you sure?
Can't apply server options.
Can't create file '%s'
Can't get exit code. Error: 0x%x
Can't write: 
Caption
Carpeta de destino:
Carpeta de sortida:
Cartella di destinazione:
Cascade Windows
Categories:	Commands:jTo add a command to a toolbar: select a category and drag the command out of this dialog box to a toolbar.	Category:
Category
CD/DVD-ROM for every burning application and in all drives!
CDebugger was detected. Please run the application without debugger.ECommand line options are disabled.
CD Label
CD-R(W) required
CD Type
&Cerrar
Certificate password:
Cet assistant vous guidera 
 cez odin
Change
Change &Button Image
Changed*Do you want to save the image before exit?
Change view
ch a upozor
. Chcete re
Chcete ru
Check1
CHECKBOX
&Check For Update
Check For Update
Check for updates
)Checking and installing .NET Framework...
Checking license error.4Service port is already used by another application.#Image catalog initialization error.#Cannot mount image to iSCSI Target.
Check security credentials.
&Chiudi
Choose Components8Choose which features of $(^NameDA) you want to install.8Move your mouse over a component to see its description.
Choose Install Location*Choose the $(^NameDA) installation folder.
chou
choz
ch Seznamu
ch Seznamu 
chte sp
Chyba dekomprimuj
Chyba otv
Chyba p
Chyba rozbalen
Chyba vytv
: chyba zapisovania s
cich d
cie 
cie,
cijas Vedni
ciju,
ciju J
ci na internetu a rychl
ciu  
Clear
Clear Cached Info0Unable to make ISO image from multisession image&Unable to make ISO image from audio CD
Clear Failed Tasks
Clear Item(s)
Clear list
Clear project
Clear Recently Used Images
Clear sectors
Clear Tree
Clica sobre Abortar per parar la instal
Clicca Arresta per bloccare l'installazione,
Clicca Avanti per continuare.
Clicca su Termina per chiudere questo wizard.
$_CLICK
Click Abort to stop the installation,
Click Finish to close this wizard.
Click Finish to close this wizard.oYour computer must be restarted in order to complete the installation of $(^NameDA). Do you want to reboot now?*Completing the $(^NameDA) Uninstall WizardW$(^NameDA) has been uninstalled from your computer.
Click Finish to close this wizard.qYour computer must be restarted in order to complete the uninstallation of $(^NameDA). Do you want to reboot now?
Click Next to continue.
Click Next to continue./Click Install button to start the installation.
$_CLICK*Welcome to the $(^NameDA) Uninstall WizardMThis wizard will guide you through the uninstallation of $(^NameDA).
Client
Client Info
Client-Port number should be in range of [0..65535].
Clients
Clique em Cancelar para parar a instala
Clique em Fechar para encerrar este assistente.
Clique em Pr
Cliquez sur annuler pour arr
Cliquez sur Suivant pour continuer.
Cliquez sur Terminer pour fermer cet assistant.
CloneCD images
Close
&Close
Close	Add Image
@Close all running applications which may use your virtual drive.5Destination File was already added to Image Catalog. 
CloseGadget
Close lookup panel
Close on finish
Closing session
cmd: %s
Color Schemes
COMBOBOX
Command line parameters:1Invalid server response or Proxy Server problems.
Commands
Comment
\Common Files
CommonFilesDir
Common Icon
Common target parameters$Specify target alias and target name
CompanyName
Compleet
Completado
Completamento del Wizard di disinstallazione di 
Completando el Asistente de Desinstalaci
Completando o asistente de desinstalaci
Completant la navegaci
Completat
Completato
Completed
: Completed
	Completed
Completing the 
Compressed:
Compressed ISO images
Compressed Size:#Confirmation password is incorrect.
Compress image data
compression est survenue ! Le programme d'installation serait corrompu ?
Computer
Computer name:
Computer name / IP address:
Computer name is empty.
 computerul dvs trebuie repornit. Dori
Conclu
Concluindo o Assistente de Desinstala
Configuraci
Configurador 
Configuring...&Install DAEMON Tools Windows Gadget...
Configuring setup components.<Setup is configuring components list. It may take some time.
Confirmation
: Confirmation
Confirmations
Confirm e-mail:SIncorrect disc type is inserted. Please insert %s disc into the destination device.%Unable to validate this installation.
Confirm password:
Connect
connected to
connecting
Connecting to
Connection
Connection settings...
"Connection to iSCSI Target failed.cMaximum number of connections to this iSCSI Target was reached. Contact your network administrator.
Connect to iSCSI Target...
CONOUT$
Contact support
Context Menu Items
Continue
Continue disc
Continue Trial
Control Panel\Desktop\ResourceLocale
Converted Name
Convert Image
Convert Image...
CONVERT IMAGE
Converting Image
Copia a
Copia Dettagli sulla Clipboard
Copia fallita
Copiar a
Copiar Detalhes para a 
Copiar Detalles al Portapapeles
Copiar detalls al portapapers
Copiar os detalles ao portapapeis
Copiar para
Copiaz
Copier dans 
Copiere 
Copiere e
Copier les d
&Copy Button Image
Copy Details to Clipboard
Copy Disc...	Copy Disc
Copy failed
Copying
Copying Disc
Copy on the fly
Copyright (C) 2004-2012
Copyright (C) 2011
Copyright (C) 2012 Yandex LLC
Copy to 
Copy to clipboard
Copy to Shared Image Catalog
 corrompido?
Country:
C:\Program Files
&Create
Create ...
Create a desktop icon...
Create copy of your disc$Remove content from rewritable discs
Create file associations.
Create folder: 
Create Folder
Create image file: %s
Create new folder
Create shortcut: 
Create usual Audio CD
Create VHD
Create VHD...
CREATE VHD
Creating VHD
crire : 
criture dans un fichier
criture du fichier :
- CRT not initialized
CRYPT_E_SECURITY_SETTINGS - The hash representing the subject or the publisher wasn't explicitly trusted by the admin and admin policy has disabled user trust. No signature, publisher or timestamp errors.
CThe disc is not empty. Please erase the disc or insert the new one.
Cue sheets files
current data will be erased%current data will be kept on the disc
Current disc:
Current disc: Refreshing...
Current disc type:
Current key:
Current License information<Click Change button if you wish to change your license type.
Current operation:
Current project contains the data imported from an image or picked up from previous disc sessions. Such compilation cannot be saved to the Astroburn project file.=Unfortunately, it is not possible to copy multisession discs.
Current Speed:
Custom
CustomfCheck the components you want to install and uncheck the components you don't want to install. $_CLICK
Custom Icon
Customizare
&Customize...
cuter : 
CYou can attach only one virtual device to the same physical device.
cz, aby zako
czenia usuwania programu 
czenie usuwania programu 
czono
 - %d
... %d%%
 /D=
(&D)
da atpakojot datus! Boj
da atverot ierakst
 dabar?
DAEMON Search
 DAEMON Tools Lite 
\DAEMON Tools Lite
\DAEMON Tools Lite\*.*
DAEMON Tools Lite
DAEMON.Tools.Lite
DAEMON Tools Lite4.47.1.0333.exe
DAEMON Tools Lite ayarlar
\DAEMON Tools Lite\DTGadget.lnk
\DAEMON Tools Lite.lnk
 DAEMON Tools Lite se nezm
DAEMON Tools Lite Setup
DAEMON Tools Lite uninstall error: 
DAEMON Tools Lite ve Yandex.Bar
DAEMON Tools mount statistics
DAEMON Tools Net Agent(Impossible to save empty Audio CD image.
DAEMON Tools Pro
DAEMON Tools Pro Agent
DAEMON Tools Pro driver error: 
DAEMON Tools Pro files
DAEMON Tools Pro Setup library
DAEMON Tools Pro virtual device
DAEMON Tools Toolbar
DAEMON Tools USB
DAEMON Tools virtual device
Daha sonra kendim ba
da izveidojot:
&Dal
Dalej >
&Dalje >
dami pabandyti v
dami praleisti 
dami sustabdyti 
dami t
dami u
daryti
daryti 
Data
Datamaskinen m
Data Server1Install Network Manager and Data Server together.
Data Servers: %d of %d
Data Servers!Please reinstall the application.
Data size:
Date
Date Created
Datorn m
 dat! Po
%d day(s) left
%d.%d.%d
%d.%d.%d.%d
dddd, MMMM dd, yyyy
d dekompresji danych! Uszkodzony plik instalatora?
 de 
DebugRSS
DebugURL
december
December
DeclinetGet all your favorite search tools in a single click! Search the web, images, videos and news and get advanced maps.
Default
Default authentication
.DEFAULT\Control Panel\International
Default device:
Default Device
&Default Style
Deinstalacija 
&Deinstaliraj
Deinstaliram
-Deinstallation
-Deinstallation fertigzustellen. Wollen Sie jetzt einen Neustart durchf
-Deinstallationsassistenten
Deinstalleren
&Deinstallieren
 deinstalliert wird.
Delete
Delete all items
Delete all items?
"Delete files after successful burn
Delete file when finished
Delete Folder
Delete image file
Delete image on failure
Delete item from Image Catalog9Ask confirmation when deleting an item from Image Catalog
Delete item(s)	Data disc
Deleting files
Den h
Denne guide vil hj
Denne veiviseren vil lede deg gjennom avinstallasjonen av 
dent
&Deploy...
Deploy Application
Deployer Tasks
Deployment
Descending
Descompactar:
Descompactar: erro ao escrever no arquivo
Description
Description:
. Deseja reiniciar agora?
Desejo reiniciar depois
Desinstal
&Desinstal
Desinstalaci
Desinstalador do 
Desinstalando
&Desinstalar
Desinstalouse 
Desintal
Desintalar 
Desktop Shortcut
Destinasjonsmappe:
Destination
Destination device:
Destination file name:
Destination Folder+Select the folder to install $(^NameDA) in:
Destination image file:
Destination path:
Detach
Details
&Details anzeigen
Details in die Zwischenablage kopieren
&Details	&Toolbars
 &detaily
 detaily do schr
 &detalii
 detalii 
Devam etmek i
Device
Device:
	Device %d
Device Identification
Device Info
Device Info...
Device label	Device ID
Device letter:
Device media info
Device Parameters
Device Parameters...
Device Parameters...)View and change virtual device parameters
Device Properties
Device Properties...
devices
Devices
Device selection	View logs
'Device %s has outstanding open handles.
Devices Info
 de votre ordinateur.
Deze wizard zal u helpen bij het verwijderen van 
Dezinstalare
Dezinstalare 
Dezinstaleaz
Dialog
diegim
Dieser Assistent hilft Ihnen bei der Deinstallation von 
Digital sign error.
 dihapus.
Din computer skal genstartes for at fuldf
DIRREQUEST
Disable
Disabled
DISABLED
Disc at Once
Disc Erasing
Disc erasing...7The disc is not empty. Would you like to pick up files?
Disc erasing completed.
Disc erasing operation failed
"Disc has been erased successfully.
Disc image
Disc Imaging
Disc imaging aborted!
Disc imaging cancelled by user.
Disc imaging completed.
Disc imaging failed.
Disc Imaging Options
Disc Imaging Progress
Disc information: %s; Label: %s;Media information: Sessions: %d; Tracks: %d; Sectors: %I64u{Associate this type of files with %s application.
Disc is empty
Disc is not empty.
Disc Juggler (*.cdi)
DiscJuggler images
Disconnect
disconnecting
Disc Soft Ltd
Disc type:
&Disinstalla
Disinstalla 
Disinstallazione
Display menus with shadows!Reset menu and toolbar usage data
distr
Distr: %s
*.dll
%d min %d sec
Dobrodo
Dobro do
Dokon
&Dokon
DOMAIN error
Doresc s
Dossier de sortie : 
Dosya a
 do teu ordenador.
Do this action for all items
download
Download
Download complete. Start installations...
Downloaded:
\downloader.log
/downloader/partneryandexbar
/downloader/partneryandexbar/partner[@name='
downloader.yandex.net
download.exe
Downloading installer: %s
Downloading rss...
Downloading$The application is ready for update.
download.yandex.ru
Down	Sections:
Do you want launch Astroburn Pro with classic interface?
Do you want launch %s with classic interface?	TOP rated
Do you want to add it anyway?
Do you want to cancel?
Do you want to continue?^Unable to add iSCSI Target! Check whether is iSCSI Adapter enabled in Network Service Manager.
Do you want to delete selected image file(s) from the list? (Note: file(s) will not be physically deleted from a storage place!)
Do you want to enable the options?
. Do you want to reboot now?
Do you want to save the image?
DPM:
DPM associated call failed*Do you want to clear recently used images?
DPM finished./Unrecoverable read error encountered on sector:!Read error encountered on sector:
DPM High Precision Enable Hardware error correction#Number of retries on bad block hit:
DPM in progress...
DPM processing completed2Read operation had hit a bad (unrecoverable) block8Read operation had hit a ECC/EDC bad (recoverable) block
DPM processing started
DPM speed:
DPM started:
d podczas zapisu do pliku
d podczas zapisu pliku:
DRAG AND DROP YOUR IMAGE HERE	More news
Drive
Drive Features
Drive is not ready
Drive is not selected
Drive letter:
Drive media changed.
\Drivers\dtcdrom.sys
DROPLIST
\DTAgent.exe
\DTAgent.exe->
\DTCommonRes.dll
\DTCommonRes.dll->
\DT.gadget
\DTGadget32.dll
\DTGadget32.dll->
\DTGadget32.dll"
\DTGadget64.dll
\DTGadget64.dll->
\DTGadget64.dll"
\DTHelper.exe
\DTHelper.exe->
\DTImgEditor.exe
\DTImgEditor.exe->
DTLite
\DTLite.exe
\DTLite.exe->
\_DTLite.xml
DT Login field should not be empty.
DTSetupHelperCommand
DTSetupHelperParameter
\DTShellHlp.exe
\DTShellHlp.exe->
DTShellHlp.exe
DT Soft
DT Soft Ltd
DTSoft Ltd
d tworzenia:
DT Yandex Setup.exe
du perkrauti v
 durante la desinstalaci
Duration
dure de d
 durumlarda uyar
DVD/CD-ROM Devices
	DVD drive
DVD region:
DVD Region
Dynamically expanding
dzam 
d zapisu:
EAdd Image to DAEMON Tools Catalog or change its properties in Catalog
ech prohl
EDelete
EDIT
&Edit Button Image
Edit Image...
Edition:
ed spu
eEngine.dll
ega ra
Egendefinert
eg ra
eho po
Ei voi kirjoittaa:
Eject
Eject disc on end action
Ejected
Ejecting
Eject Tray
Ejecutar:
ejete si jej nyn
ejmenov
ekajte dok se 
ekejte ne
Eksekusi:
Ekstrahiraj:
Ekstrahiraj: napaka pri pisanju datoteke
Ekstrak:
Ekstrakcija:
Ekstrakcija: gre
Ekstrak: eror saat menulis ke berkas
Elapsed time:
elevated: %s
 elhagy
elim da ru
elim kasnije ru
elim ro
elite li odmah da restartujete?
elite li sada ponovno pokrenuti ra
elite li to u
elite ra
elite zaklju
elom dokon
El ordenador debe reiniciarse para completar la desinstalaci
El seu ordinador ha de ser reiniciat per tal de completar la desinstal
 elt
 Elt
&Elt
E-mail:
Empty
Empty disc
em Repetir para tentar novamente, ou
Emulates bad sectors and sub-channel on some old applications copied to CD-R/RW media.
Emulates bad sectors on some old applications copied to CD-R/RW media.
Emulates physical structure on recoded media written with RMPS option.
Emulates sub-channel on some old applications copied to CD-R/RW media.
&Emulation
	Emulation
em zap
Enable authentication
Enable command line options
Enabled
Enable HTTP Server
Enable Image Catalog sharing
Enable iSCSI Adapter
Enable Media Info panel)Show panel on the left side of the window*Show panel on the right side of the window
Enable %s command line options
Enable shell extensions4Integrate DTPro actions into Explorer's context menu Create personal folder for image
ena datoteka 
ena instalacija?
ende
End sector:
End work. Quit.
\Engine.dll
\Engine.dll->
Engine error code:
English
Enhanced DAEMON Tools features
enie tohto s
eno)
< &Enrera
ent >
Enter image password
Enter password:
Entpacken: 
Entpacken: Fehler beim Schreiben in Datei 
ent per continuar.
ENU.dll
e pisati:
e program 
e pro pohodlnou pr
e ra
Erase Disc
Erase Disc...
ERASE DISC
Erasing speed:
Erasing type:
 eri
Eroare la creare :
Eroare la decomprimarea datelor! Program de instalare corupt ?
Eroare la scriere la fi
Eror membuat:
Eror mengekstrak data! Mungkin Instaler telah rusak?
Erro ao abrir arquivo para grava
Erro ao abrir o arquivo para instalar:
Erro ao copiar
Erro ao criar:
Erro descompactando dados! O Instalador est
error
Error
Error: 0x%x
Error al abrir el archivo para escritura:
Error al crear:
Error al descomprimir los datos! 
Error! Can't initialize plug-ins directory. Please try again later.
Error creant:
Error creating: 
error creating dialog
Error creating: .Error decompressing data! Corrupted installer?
Error creating shortcut: 
Error decompressing data! Corrupted installer?
Error descomprimint dades. Instal
Errore di creazione:
Errore di decompressione dati! Installer corrotto?
Errore nell'apertura del file per la scrittura: 
error finding childwnd
error finding config
error finding mainwnd
Error in command line.
Error is: 0x%x.
Error launching installer
Error obrint l'arxiu per escriptura:
|Error opening file for writing: 
Error opening file for writing: 
Error reading sub-channel file.
Error registering DLL	Execute: 	Extract: 
Error writing temporary file. Make sure your temp folder is valid.
Esegui:
 est
Este asistente le guiar
Este assistente o guiar
Estrai:
Estrazione: Errore nella scrittura sul file
etak 
e vas provesti kroz deinstalaciju 
e Vas provesti kroz postupak uklanjanja 
e vas voditi kroz uklanjanje 
Event
	Exceeded:
Exceeded space
Exceeded space is
Exceeded time is
.exe
Executar:
Executare :
Execute: 
Exibir &detalhes
exist
Exit
E&xit
Exit)Ask confirmation to close the application
Exit code: 0x%x
Explorer Bar
Explorer Panel
Export settings0No such host is known or computer is turned off:
exp_path
Extended media descriptor files
EXTENDEDSELCT
Extract: 
Extract...
Extract: error writing to file 
Extracting files
Extraer:
Extraer: error al escribir en el archivo
Extragere :
Extragere : eroare la scrierea 
Extrahera:
Extrahering: gick ej att skriva fil
Extrahova
Extrahuji: 
Extrahuji: chyba z
Extraire : 
Extraire : erreur d'
Extreure:
Extreure: Error escrivint a l'arxiu
Ez a var
(&F)
f3fff
{F7F126C7-43D4-491c-AC47-9F0746EA80B2}
 fail
failed
Failed
Failed to create image file: %sc%s can't launch without .NET Framework 4.0 installed.
Failed to delete file:
Failed to erase disc
Failed to generate certificate
Failed to get icon.
Failed to launch File ExploreruIf you enable Hide CD-R option, you will not be able to burn discs in any program! Are you sure you want to continue?
Failed to move image storage.)Failed to create image storage directory..Failed to create image link storage directory.
Failed to read source image.!Failed to save data to new image.
Failed to restart the system.
Failed to send OPC
Failed to set BUP
Failed to start taskcFilesystem on the target drive doesn't allow to create the files of such size, please use splittingJYou may not have enough space on the target drive. Do you want to proceed?
Failed to update target
Falha na c
fallback
fb: %s
february
February
&Fechar
Fehler beim 
Fehler beim Entpacken der Daten! M
Fehler beim Erstellen von: 
Feil under 
Feil under dekomprimering av data! Korrupt installasjonspakke?
Feil under opprettelse av:
Fel vid skrivning av fil: 
Fel vid uppackning av data! Fel p
Fermer
Fertiggestellt
&Fertigstellen
Fertigstellung des 
ffnen der zu schreibenden Datei: 
[Field 1]
Field 1
[Field 2]
Field 2
[Field 3]
Field 3
Field 4
Field 5
Field %d
Field must not be empty Value should contain only digits
&File
File Associations
File contains no data.
FileDescription
File doesn't exist: %s
File downloading complete: %s, size: %d
File &Explorer
FILE_EXPLORER
FILE_HIDEREADONLY
FILE_MUST_EXIST
File name is empty.
File not accessible.
File path is too long.
FILEREQUEST
Files
Files count:
File system
File system:
File types:
FileTypesSave
FileVersion
Filter
Filter:
&Finalitzar
Finalize
Finalized disc
Fin de la d
Find your favorite discs on %s to discover the image files you are mounting, games you are playing, music you are listening to and more.
&Finish
&Finish$Are you sure you want to quit Setup?1Are you sure you want to quit $(^Name) Uninstall?
Finish burning
Finished successfully
Finished with errors
Finish previous operation.
Fixed size
flac
Flags
Flags=RESIZETOFIT
- floating point support not loaded
Floppy Emulation 1.20MB
Floppy Emulation 1.44MB
Floppy Emulation 2.88MB
FOCUS
 foi desinstalado do seu computador.
Folder
Folder Description:
Folder destina
Folder docelowy:
Folder name:
Folder properties
Folders
Folders count:
Force
Force Plugin:
ForceRemove
Format
 fortsette.
Forum*The previous operation has to be finished.
For using type: downloader.exe --partner <name> [--distr <params>] [--try] <download try count> [--sync]
Fout bij het maken:
Fout bij het openen van bestand voor schrijven:
Fout decomprimeren data! Corrupte installer?
-free
Free
Free:
Free license
Free License
Free Lossless Audio Codec
Free size:
Free space
Free space:
Free time:'You have to input boot image file name.
Free Upgrades period expired.
Friday
fThe project contains only pick-up file(s) or empty file(s). Are you sure you want to burn the project?(Unable to burn files from the same media
fThis wizard will guide you through the steps required to install $(^NameDA) on your computer.
Fuldf
&Fuldf
-full
Full erase
 fullf
Fullf
&Fullf
Full size:
Full time:
Gagal menyalin
g a(z) 
geldiniz
Gelieve te wachten terwijl $ (^NameDA) wordt gedeinstalleerd.
General
Generate certificate
Generate SSL certificate
Generating certificate...
Genstart nu
 gerekmektedir. 
< &Geri
@Get featured enhancements, plug-ins and more, all updated daily.
GetParamStr
GetStr
Gick ej skapa:
g igen for at pr
gigvezeti a(z) 
Gi nytt navn:
gleda dig genom avinstallationen av 
glicherweise ein defektes Installationspaket?
Global\{701E83F0-0EDB-4be1-B106-BB7F659EB391}
Global\{8B2189B8-E348-4d55-9C32-FB5EEC972D67}
Google Chrome installation....Adds icons to your Start Menu for easy access.
gots
grehajt
Grje
GROUP
GROUPBOX
Group converting
Group items$Unable to find activated %s license.
                                 H
         (((((                  H
Habitual
 ha estat desinstal
Ha fallat la c
Hai que reiniciar o ordenador para completar a desinstalaci
Haluan itse k
 har avinstallerats. 
 har blitt fjernet fra din maskin.
Hard Drive Emulation
Hardware error correction
 has been uninstalled from your computer.
 ha sido desinstalado de su ordenador.
Help
&Help
hemmin
hez 
         h((((                  H
HH:mm:ss
Hiba a f
H&ide CD-R
HideJTo apply changes, you need to reboot system. Would you like to reboot now?QTo apply changes, you need to restart application. Would you like to restart now?
Hide Media Info panel
Hides recordable media from applications.
 Highlight rarely used menu items
 hledan
HLINE
Hlp1
Hlp2
Home
	Home Page
ho po
 hoppe over denne filen.
host
Host:
Host or Port is not specified.&Username or password is not specified.	Attaching
Hot keys
Hot keys...
Hot key settings:
&Hot Tasks
hoz,
hoz.
hren
hren: 
hren?
hrend 
HRESULT: 0x%08X
HSCROLL
Http
http://downloader.yandex.net/yandex-pack/
http://downloader.yandex.net/yandex-pack/downloader/info.rss
http://download.yandex.ru/yandex-pack/downloader/info.rss
http://nsis.sf.net/NSIS_Error
HTTP port:
Https
HTTP server settings
HTTPs port:
https://secure.disc-soft.com/account/serials
https://secure.disc-soft.com/payment/dtLite,1
http://www.daemon-tools.cc/eng/feedback/
HWND
HWND2
_Hyperlink_Object_Pointer_\{AFEED740-CC6D-47c5-831D-9848FD916EEF}
(i 276)
(i 284)
i Abort/
iActivation server is in maintenance mode.
i acum ?
I &Agree
iama:
iama: klaida 
i ana sayfa olarak ayarla ve de
iant duomenis! Sugadinta diegimo programa?
Ich m
ICON
iConnection to server failed.
Icons
Ico&ns
i da bi zatvorili prozor.
i da presko
i &detalje
ie :
ier.
ierul : 
ie v
If you have inactive instances slots in your license you can just reactivate using one. Otherwise go to your account page, revoke your previous activation and after that you will be able to activate %s instance with new System ID.
If you need some help, use %s form.
Ignor
Ignora per saltare questo file.
Ignorar para n
Ignorar para saltar este archivo.
"Ignorar" para saltar este arquivo.
Ignorar per saltar aquest arxiu.
Ignore
Ignore bad blocks:
Ignore/Ignorare pentru a s
Ignorera f
Ignorer for 
Ignorer pour passer au fichier suivant.
Ignore to skip this file.
Ignori
Ignorieren, um diese Datei zu 
Ignoriraj da presko
Ignorova
Ignorovat pro vynech
Ignoruj, aby pomin
Ignoruoti
Ihr Computer muss neugestartet werden, um die 
iklik yap
Ik wil later handmatig opnieuw opstarten.
&Ileri >
ili deinstalaciju 
ILIGHT=1
ILIGHT="""1"""
ILIGHT="1"
ili ovu datoteku.
ili s uklanjanjem 
ilo. 
Il tuo computer deve essere riavviato per poter completare la disinstallazione di 
Image
Image:
Image &and Text
Image burning
Image burning failed
Image Catalog
Image catalog folder:
Image Catalog Folder::Do not select images that are already in the Image Catalog
Image Catalog Options
Image converting finished
Image converting started
Image Editor
Image file path:	Sessions:
Image File Types:
Image icon:
Image Icon
 Image in DAEMON Tools Catalog...
Image Info
Image Info...
Image may be corrupted.9Track number mismatch. Sub-channel file may be corrupted.
Image media info
Image Name
Image parameters
Image path:
Image Path
Image &permissions...
Image Properties
Images
Image "%s" already exists
Image saved to file:"Grabbed %d session(s), %d track(s)
Image Saving
Image size mismatch.;Invalid CCD format. File may be corrupt or has old version.
Images Search
Image Topology Information
Image Topology Information...
Image type
imdi ba
\ImgEngine.dll
\ImgEngine.dll->
imi sa
im obl
Import From Image
Import From Image...
Importing files
in ara
in bilgisayar
Include subfolders
incomplete download and damaged media. Contact the
Incorrect number.
Incorrect settings7Unable to perform operation. Current device is invalid.LYou cannot mount image to virtual IDE device from image on same IDE channel.
Index
< &Indietro
&Info Panel
Info Panel
Info Panel	Disc info
Information
iniet T
initDialog
initi?
Initialization...
Initializing driver...
InitLang
in l
In Progress...	Uninstall
Input password:
Insert blank disc.
+Insert CD-R or CD-RW disc to burn Audio CD.
in size yard
 instal
Instal
 instalace,
 instalace (doporu
Instalaci a pou
Instalacija 
 instalacijski 
 instalacj
Instalacja 
Instalador corrupto?
Instalador do 
Instalare 
 instalatora.
&Install
 - installasjon
 installation
Installation
Installation Aborted
Installation Complete!Setup was completed successfully.
: Installation Folder
&Installation Name...
Installation Name:
: Installation Options
Installation Type$Please choose the Installation type.9Please choose computer where Network Manager is installed
Install Client
Install core files...
Install Data Server only. Install DAEMON Tools Net Client.TDAEMON Tools Net Network Manager should be available in your Network for activation.!Common components uninstalling...
Installer corrupted: invalid opcode
Installer integrity check has failed. Common causes include
installer's author to obtain a new copy.
\InstallGadget.exe"
Install Google Chrome
Install Google Toolbar-Google Chrome, a faster way to browse the web
: Installing
Installing0Please wait while $(^NameDA) is being installed.
Install Network Manager only.
\InstallOptions.dll
Install Server
Install shell extensions...+Create a program group in the Start menu...%External components initialization...
Install SPTD...aActivate a license for personal and non-commercial use. Full technical support is not guaranteed.
Instalovat DAEMON Tools Lite a n
Instalovat Yandex.Bar Seznam Edition
Instant CD/DVD images
Insufficient disc space
Insufficient privileges.
in Tamamla tu
Integrate with Windows Explorer2Integrate %s actions into Explorer's context menu.
Integration
in Tekrar dene, veya
Interface language
InternalName
Internet connection settings
 internette rahat 
Intstall advanced emulation UI
In Use
@Invalid BWT format. File may be corrupt or have unknown version.
Invalid DVD protection based on CSS flag
Invalid folder name.
Invalid image file.
Invalid image file/The disc is not empty. Do you want to clean it?
Invalid image type.
Invalid IP adrress or hostname#VHD Must Be in range of 12MB to 2TB9Value can not begin from 0 and should contain only digits
Invalid password.
Invalid Serial number.
Invalid server response.
Invalid split size.
Invert All
in Yoksay tu
\ioSpecial.ini
i otev
IP Address	connected
i &podrobnosti
 is being uninstalled.
iSCSI
iSCSI Network
iSCSI Options
iSCSI port:
iSCSI Servers
iSCSI Servers...
iSCSI Target info
iSCSI Targets
iSCSI Targets>Before restarting, save any open files and close all programs.pThe computer name contains characters which are not allowed. Please do not use `~!@#$^&*()+=[]{}\:;'",|<>/ and ? Use Explorer Namespace extension,Max connection number cannot be less than 1.
(i.s,i.r1,i.r2,i.r3,i.s,&t128.s,&i2.s,&i2,&i2,&i1.s,&i1)
IsNeedGadget
is vedlys jus ves per 
is vednis Jums pal
 is verwijderd van u computer.
ite datoteku.
Item %s already exists.$Unable to add files larger than 4Gb."Checking for available updates ...
ite ovu datoteku.
i terminarea dezinstal
i Terminare pentru a 
ite to datoteko.
iti odstranjevanje 
it pro zastaven
it pro zav
It will be done automatically when Internet connection will be available or you can do it manually via License dialog.
i venit la dezinstalarea 
I want to manually reboot later
Izejas mape:
Izhodna mapa:
Izlazni direktorijum:
Izlazni folder:
Izvr
Jag vill starta om manuellt vid senare tillf
january
January
 je bil odstranjen iz va
 je deinstaliran sa va
je dopln
Jeg genstarter manuelt senere
Jeg vil manuelt ta omstart senere
Jetzt neustarten
 je uklonjen sa Va
 je uklonjen s Va
Je veux red
jInitiator CHAP secret given is invalid. Maximum size of CHAP secret is 16 bytes. Minimum size is 12 bytes.
jjjjj
jlba 
jl kihagy
jraind
jra k
jra kell ind
jrapr
July
june
June
ka: 
 kabul etmi
kajte pokia
 kald
Kald
 Kald
&Kald
KAll contents in current Image Catalog folder will be deleted. Are you sure?
Kan ikke skrive:
Kan ikke skrive til:
Kan inte skriva:
Kan niet schrijven:
&Kapat
 kapatmak i
ka pri dekompresiji podataka! O
ka priliko kreiranja:
ka prilikom dekompresije podataka! Neispravan instalaciona datoteka?
ka prilikom pisanja:
ka prilikom pisanja u datoteku
ka pri otvaranju datoteke za pisanje:
ka pri pisanju u datoteku
ka pri pravljenju:
ka pri zapisivanju datoteke
kart:
kartma i
Kartoti
Kattintson a Befejez
Kattintson a Megszak
ka u dekomresovanju podataka! O
ka u stvaranju:
k a(z) 
KB/s
KB/Sec
< &Kembali
kernel32
kernel32::CloseHandle(i) i(R0)
kernel32.dll
KERNEL32.DLL
kernel32::GetVersionEx(ir0)i.r3
kernel32::OpenMutex(i, i, t) i(1, 0, "Global\{BBCE738A-D4CB-4da8-99D2-7DC90CB671EF}") .R0
Kernel debugger must be deactivated.!Computer Data Disc (unprotected).
Kesalahan membuka berkas untuk penulisan:
Keyboard	Customize
Kicsomagol
k igen f
Kihagy
Kimeneti mappa:
&Klaar
Klaida atidarant fail
Klaida i
Klaida sukuriant:
k lai turpin
 klas
klemeyi durdurmak i
Klicka p
Klicken Sie auf Abbrechen, um die Installation abzubrechen,
Klicken Sie auf Fertigstellen, um diesen Assistenten zu schlie
Klicken Sie auf Weiter, um fortzusetzen.
Klik
Klik Afbreken om de installatie te stoppen,
Klik Batal untuk menghentikan instalasi.
Klik Berikut untuk melanjutkan.
Klikk Avbryt for 
Klikk Fullf
Klik Klaar om de wizard te sluiten.
Klikk Neste for 
Klikn
Kliknij Dalej, aby kontynuowa
Kliknij Przerwij, aby zatrzyma
Kliknij Zako
Klikni Kon
Kliknite na 
Kliknite na Dokon
Kliknite Napred za nastavak
Kliknite Naprej da nadaljujete.
Kliknite na Preru
Kliknite Odustani da zaustavite instalaciju,
Kliknite Prekini da zaustavite namestitev,
Kliknite Zavr
Klik Selesai untuk menutup Wizard.
Klik Volgende om verder te gaan.
 kompiuterio.
 kompiuteris privalo b
Kompletn
Komputer anda harus direstart untuk menyelesaikan proses penghapusan 
&Kon
 koneesi uudelleen nyt?
 kone nyt uudelleen
 konieczne jest ponowne uruchomienie komputera. Czy chcesz zrestartowa
Konnte nicht geschrieben werden: 
Kopiera detaljer till urklippshanteraren
Kopiera till
Kopier Details naar Klembord
Kopier detaljer til udklipsholderen
Kopier detaljer til utklippstavlen
Kopieren fehlgeschlagen
Kopieren mislukt
kopieren naar
Kopieren nach 
Kopiering fejlede
Kopiering mislyktes
Kopiering misslyckades
Kopier til
Kopijavimas nepavyko
Kopijuoti 
Kopioi kohteeseen
Kopiointi ep
Kopioi yksityiskohdat leikep
Kopiowanie nie powiod
Kopiraj detalje u Clipboard
Kopiraj detalje u me
Kopiraj podrobnosti v odlo
Kopiraj u
Kopiraj v
Kopiranje detalja u me
Kopiranje neuspe
Kopiranje neuspjelo
Kopiranje nije uspjelo
Kopiranje u
Kopiuj do
Kopyala
Kopyalama ba
kozen
k prohl
&Kraj
Kreator poprowadzi Ci
ksesi t
Kunne ikke 
Kunne ikke dekomprimere data! Korrupt installationsprogram?
Kunne ikke oprette:
 kurarak, 
 Kurulumu
KYou are going to activate a Trial License to evaluate the product features.+Please enter information for %s activation.
Laat &details zien
label:
Label
Label:
LABEL
+Label to easily identify your installation.[Selected DAEMON Tools Pro edition will be activated for evaluation of the product features.CNote: Internet connection is required for successful %s activation.iYour Serial Number is located in your e-mail receipt from disc-soft.com or in your disc-soft.com account:
laci
La copia ha fallado
La copie a 
lador corrupte?
La guia et portar
 laikin
Lai pabeigtu 
Laipni l
\Lang
\Lang\
\Lang\*.dll
\Lang\*.dll->
\Lang\*.DLL
Language
LanguageNEnables/disables saving current layout as preferred layout on application exit
lant
lapra
Large icons in menus
Large icons in toolbars
Last Check
Last Mounted Drive
Last Mounted Time
lat.
lat en el seu ordinador.
Later
Latest news
Latest News
laties restart
latmak istiyor musunuz?
latmak istiyorum
)Launch %s automatically on system startup	AutomountUAutomatically remount on startup images that were mounted when previous session ended
layan taray
Layout
Lead-Out
Leave
Left
LEFT
Left=0
Left=120
Legacy name:*The application is ready for installation.
LegalCopyright
lemedi! Kurulum dosyas
lemi
lemi : dosya yaz
lemine ge
lemini tamamlamak i
Length
leri >
leri tu
less than 1 min.
Letter
liau
Licen
License
License...
License	Add Files
: License Agreement
License Agreement=Please review the license terms before installing $(^NameDA).yIf you accept the terms of the agreement, click I Agree to continue. You must accept the agreement to install $(^NameDA).1Press Page Down to see the rest of the agreement.
License checking
License is activated on another system.
License Manager
License &Manager...
License Type
License validation warning
License verification...
License verification failed.
Lihat &detail
liin.
LINK
Lisans S
List
&List
LISTBOX
ListItems
list == NULL!!
li u 
li v 
lkommen till 
lkoz
lla avinstallationen av 
lmapp:
lmas
Load
Loading
Loading...
Load segment of sector:
	Load Tray
loadXML error
Local Devices
Local disc
Local Settings\Software\Microsoft\Windows\Shell\MuiCache
Locate Image File
Location
Locked Applications List
Locked list applications
Lock media during grab
L&ock Panels
Lock Panels
Login:
Login dialog	New Image
Login or password is incorrect%DAEMON Tools Net Service is disabled!
Logoff
Logon
Lookup
' lopettaaksesi asennuksen, 
lpe dig med afinstallationens af 
lreiz, vai
l, spauskite
lt a telep
lt_name
lt: %s
&Luk
&Lukk
 lukke denne veiviseren.
Main color:
Make an image from disc
Make bootable PC disc
Make Disc Image
Make Disc Image...
MAKE DISC IMAGE
Make new disc
Make New Image...
Manage
Manual0Support is provided only for Paid License users.qYour %s License will be assigned to this e-mail address. It is needed for further License management and support.
march
March
Mark all items as read
Mark all items as unread
marr
marrer maintenant
marrer maintenant ?
marrer manuellement plus tard
Max connections:
Max Connections
Maximum
Maximum number of items:
Maximum read speed:
Maximum write speed:
MaxLen
max sectors
MDS/MDF image
meden 
Media
Media code:
Media descriptor files
Media Icon
Media Info
Media information:
Media inserted
Media topology emulation
 megnyit
Menguninstal
Menu
Menu animations:
Menyelesaikan Uninstal Wizard 
&Merge
mesi
Message
\Microsoft\Internet Explorer\Quick Launch
@Microsoft Visual C++ Runtime Library
Microsoft Visual C++ Runtime Library
\Microsoft\Windows Sidebar\Gadgets\DT.gadget
min.
Minimize2Switch to background mode while burning or erasing$Please, restart %s to apply changes.
Minimize to tray on closeCMinimize main window to the system tray on close or pressing Alt+F4
MinLen
mi podm
miyor
MM/dd/yy
m na Dal
Mode
Model
\modern-header.bmp
\modern-wizard.bmp
m odinstalace, se ujist
mo failu:
Molimo sa
Molim pri
Molim sa
Monday
Monkey's Audio
More info...
More info...;Destination file already exists. Do you want to replace it?
More information at:
More reviews
More Switch Media Info panel position
Most Played
Mostra &dettagli
Mostrar &detalles
Mostrar &detalls
Mount
&Mount
Mount device...
Mounted Folder
Mounted folder:	Location:
Mounted image
Mount Image
Mount Image...
Mount image on virtual drive
Mount in Advanced Mode...$Unrecognized media or invalid format
Mounting image
Mount on Default Device
Mount on Last Mounted Device	Hot Tasks
Mount on %s
Mount on the first empty device
Mount...ORecently Used Images is a special folder. Items cannot be added to it directly.
Mount physical optical device
Mount Point
Mount %s9You already have the maximum number of virtual %s drives.,Do you really want to remove selected drive?)Do you really want to unmount all drives?
Mount to
Mount to folder
Mount to the first device:'You can use the same hot key only once./Other applications already use the hot key(s): ,The hot keys cannot be used by DAEMON Tools.
Mount/unmount:
Mount virtual CD/DVD-ROM
Mount virtual hard disk
Mount virtual optical device
Move Up	Move Down
MPEG-1/2/2.5 Audio Layer 3
m po
mscoree.dll
msctls_progress32
MS Sans Serif
MS Shell Dlg
m str
Mukautettu
MULTILINE
MULTISELECT
 mus
m Yandex.Baru Seznam Edition souhlas
My Licenses
My Licenses on Disc-Soft.com
(&N)>
(&N) >
Naam weizigen:
na Ho
nainte >
nainte pentru a continua.
nak befejez
nak folyamat
na mapa:
name
Name
Name:
Name	Completed
$(^NameDA)
Name in Image Catalog:
Name in Image Catalog is empty.8End sector value cannot be less than Start sector value.
name: %s
$(^Name) Setup
 Namestitev
$(^Name) Uninstall
Napaka odpiranja datoteke za pisanje:
Napaka pri dekompresiranju podatkov! Pokvarjeni namestitveni program?
Napaka pri ustvarjanju:
napoi
N&apred >
&Naprej >
n asennusohjelman.
&Nastavak >
Nastaven
Nastavit Seznam.cz jako domovskou str
Nastavit v
< &Nazad
< &Nazaj
n bozuk olmad
nce, l
ncerca din nou sau 
ncercare pentru a 
ncheia dezinstalarea 
ncheiat(
ncheiere dezinstalare 
n&chide
nchide aceast
ncia
NCRC
ndan emin misiniz?
n de 
ndeki
 nebude odin
 ne deinstalira.
Negali ra
 Negeren om het bestand over te slaan.
Nelze zapsat: 
Nem 
 nem fut.
Nemogu
Ne mogu pisati:
Ne morem zapisati:
 nen
Ne peut pas 
ne re
Nero ImageDrive Virtual Device
Nero images
 nesk
&Neste >
nete odstranitev se prepri
Network
Network:
Network disc
Network Images!Please specify %s server address.
Network Manager
\Network Manager.lnk
 Network Manager with Data Server
Network Service Manager
&Network Services Manager...
 ne ukloni s ra
Nevar ierakst
New Folder
New iSCSI Target
New partner name: %s
New password:
New Project
News
New version is available.
Next
&Next >
NextButtonText
n fi
nga guiden.
niej
 nie jest uruchomiony.
Nije mogu
NImage %s is already present in catalog. Do you want to refresh its properties?
Nime
 ni zagnan.
nja ind
n kald
nkami.
n kapal
nku ve v
nlig v
n meg, hogy a(z) 
n memoria temporar
No data.
No device selected.
No Devices were found.
No disc&Specified virtual drive doesn't exist.
No Emulation
No es pot escriure:
No images added.
No item selected
no label
No Media
Noname
None
Non posso scrivere:
Non se pode instalar:
No OLE for: 
no ponovno pokrenuti ra
no ponovno zagnati kasneje
, nor
NoRemove
no resetujem kasnije
 noriu rankiniu b
No se puede escribir:
No servers added
No shared devices
no split6The directory doesn't exist. Do you want to create it?
NOTABSTOP
not connected
Note: If the email will not reach you within 15 minutes, please try
- not enough space for arguments
- not enough space for environment
- not enough space for locale information
- not enough space for lowio initialization
- not enough space for _onexit/atexit table
- not enough space for stdio initialization
- not enough space for thread data
Note: these options shouldn't be used for ordinary standard media. It is strongly recommended for use by experienced users only.
Not formatted disc9Disc is not ready for burning. Erase disc before burning.
NOTIFY
Not installed
Not needed for normal image in virtual drive.
Not needed for normal image in virtual drive. Be very careful with this option usage,
not set	Autostart%Unmount virtual drive when it is used
Not supported
Not supported disc+Insert CD-R or CD-RW disc to burn Audio CD.
No updates available.(License has not been validated properly!
november
November
NOWORDWRAP
n. P
n procesul de dezinstalare a 
NSIS Error
nsker du 
~nsu.tmp
nta medans 
n tiedoston v
ntrerupere pentru a opri instalarea,
Nukopijuoti detales 
(null)
NULL
<NULL>
Number
Number of loaded sectors:USource image file is invalid or unaccessible. Check authentication for network image.
Numfields
NumFields
NumFields=3
Nu opnieuw opstarten
Nu se poate scrie :
Nutraukti
n yeniden ba
 nytt, eller
 nytt for 
 nytt n
n z Va
o considerar este arquivo.
october
October
 odin
Odin
 Odin
&Odin
 odinstalace 
Odinstalace 
Odinstalov
&Odinstalovat
Odinstal&uj
 odinstaluje. 
o do 
Odota kunnes 
Odredi
Odstranitev 
 Odstranjevalni 
Odstranjevanje
Odustani
Offline
o foi poss
'Ohita' j
 -ohjelman asennuksen poistoon
 -ohjelman asennuksen poisto on valmis
 -ohjelman asennuksen poisto saadaan valmiiksi. Haluatko k
 -ohjelman asennus on poistettu.
 -ohjelman asennus on poistettu koneeltasi.
 olacakt
 oldu
 oluyorsunuz
ome palaukti kol 
Online
Online Help
Online &Help
ONLY_NUMBERS
onnistui
Oops after %d bytes.
Opakova
Opakovat pro nov
open
Open...
Open certificate
Open Containing Folder
Open DAEMON Tools Lite
Open DAEMON Tools Lite on start
Open DAEMON Tools Net
Open DAEMON Tools Pro
Open device exclusively
Open Image
Open in File Explorer
Open Project
\OpenWithProgids
*Operation failed. Activation was rejected.$Second instance of setup is running.
Operation failed*Are you sure you want to cancel operation?
Opnieuw om opnieuw te proberen, of
Options
&Options
Options:
Options...
Organization:
OriginalFilename
OS3Selected image cannot be added to Audio CD project."Unable to burn multisession image.
o si
os: %s
 ostranjuje.
Other
Otherwise, you can %s for this license.
Otpakiravanje:
Otpakiravanje: grje
Output file:
Output folder:
Output folder: 
Output format:
Output mappe:
Ovaj 
ovanie.
ovat na pokus o zm
o vedni.
Pabeidz 
&Pabeigt
Pabeigts
Paid
Paid license
Paid License
Pakk ut:
Pakk ut: feil under skriving til fil
 panelidir.
 panelini kur
Panels
 Panoya Kopyala
Parameters
 parametr
Params: '%s'
Parent Folder
Parse rss
partner
partner == NULL!!
Pasirinktinai
 passo a passo na desinstala
Password
	Password:
Password:
PASSWORD
Password field cannot be empty.	Instances
Password Protected:
Password protection
Pasta de sa
&Paste Button Image
Path
Path:
Path format is not valid
PATH_MUST_EXIST
Path to certificate file:
Pause
&Pechar
Pentru a 
Per favor, espera mentre 
Perkrauti dabar
Personalizado
Personalized Menus and Toolbars
Personalizzato
Personnalis
Peruuta
Pervadinama:
pet. 
Physical CD/DVD Devices
Physical device
Physical device info
Physical Devices
Physical optical device
Physical optical device mount&Specify properties for physical device
Pick up existing data
Piel
Pilnas
\\.\pipe\DTShellHelper-
pis: 
pisu do souboru 
Planing size:
Planned:
Planned space
Planning time:
Play
Please check input values'Please specify valid filename for image
Please check your mailbox.The email has been sent to %s. You must use activation link present in registration email prior to continue installation.
Please check your network connection and any firewall software you may have.JLicense validation failed. After some time you will not be able to use %s.BYour time limit of working without License validation has expired.
Please close %s to continue..Unable to make ISO image for multisession disc1Unable to burn multisession image on DVDRW discs.
#Please confirm your e-mail address.
Please connect to the Internet or contact us for technical support if you do have an Internet connection on your computer and you still see this message.
Please contact support.
Please enter image password:
:Please purchase full %s license to continue program usage.
Please reboot your computer.	MDX image9Display name for you to identify this installation later.(Your license was validated successfully.
Please select disc.FRestart is required to enable the changes. Do you want to restart now?
Please select Image.[You cannot add images to the current folder. Do you want to add to the root folder instead?
Please select language.
Please select target device.
Please select Virtual Device>Drag-and-drop the image to the device if you want to mount it.ROnly one item can be mounted on a device. Dropping of several items isn't allowed.
Please specify image file path
Please specify partner name.
Please specify target alias.
Please specify target name.1Maximum connections value must be more than zero.
Please try again or use a different e-mail to register your License.
Please try to activate later.
Please, verify now or you can try later.
Please wait...
Please wait while 
Please wait while Setup is loading...
Plugin
\Plugins
Plus les &d
pning av fil for skriving: 
 poczeka
 Pode
&Podrobnosti
Poista asennus
Poka
Pokra
Poku
 pokus
 pokus, alebo
Poljubno
Poni
Ponovi kako biste ponovno poku
Ponovni zagon
Ponovno pokretanje odmah
Ponovno poskusi da poskusite znova, ali
Ponovo da poku
 ponownie, 
 ponownie komputer p
Por favor aguarde enquanto o 
Por favor espere mientras se desinstala 
port
Port:
Port.The target with specified name already exists!
 pour pouvoir achever l'installation de 
< &Povratak
< Pr
 prac
precision - 
Preden za
Preferences
&Preferences...
Preferences...
Preimenovanje:
Preimenuj:
Prekli
Premastering tree is empty.
Preme en "Cancelar" para deter a instalaci
Preme en "Rematar" para pechar este asistente.
Preme en "Seguinte" para continuar
Premenova
Prem Finalitzar per tancar aquesta finestra.
Prem Seg
 pre nov
Preparing for burning....Are you sure you want to create a new project?
 pre pokra
 pre presko
Press new shortcut key:
Previous
 pre zastavenie in
 pre zatvorenie sprevodcu.
Prika
Prikaz &detalja
Prilago
Pritisnite Dalje za nastavak.
Pritisnite Kraj kako biste zatvorili ovaj 
Pritisnite Nastavak kako biste nastavili.
Pritisnite Odustani kako biste zaustavili instalaciju,
Pritisnite Prekini za zaustavljanje instalacije,
Privacy SettingsADetailed information about the privacy protections is in %s EULA.+Allow MountSpace to use my mount statistics
Processing
Pro dokon
Product identification:
ProductName
Product revision level:
ProductVersion
Profile:
Profile name:
\Profiles.ini
\Profiles.ini->
Progid
Program 
Program: 
ProgramFilesDir
Programme de d
Programme d'installation de 
Programm wird deinstalliert
<program name unknown>
Prolong
Prolong Free Upgrades period to install this software version. Otherwise, you can download older setup files at %s page.
PROMPT_CREATE
Properties
Properties...
Property
Pros
Prosimo po
Prosz
Protected disc
Protect image with password:
Protection:
 przez proces usuwania programu 
ptal
ptal,
Pulse Abortar para detener la instalaci
Pulse Siguiente para continuar.
Pulse Terminar para cerrar este asistente.
Pura:
Pura: virhe kirjoitettaessa tiedostoon
- pure virtual function call
QThese files will be renamed. Their names will be changed according to 8+3 format:
. Queres reiniciar agora?
Quero reiniciar manualmente despois
Questo wizard vi guider
Quick erase
Quiere reiniciar ahora?
Quiero reiniciar manualmente m
Quit the application
R6002
R6008
R6009
R6010
R6016
R6017
R6018
R6019
R6024
R6025
R6026
R6027
R6028
R6030
R6031
R6032
R6033
RadioButton
RADIOBUTTON
RAM disc
rania:
rania s
ranka
rApplication
Raspakivanje: gre
Raspakuj:
r att avbryta installationen,
r att f
r att forts
r att prova p
r att skippa filen.
r att st
r avinstallationguiden f
rdigst
rea de Transfer
Reading speed:
Reading track %d of %d
READONLY
Read operation was retried
re afinstallationen af 
,Reboot is required after previous operation.
.Reboot is required for changes to take effect.
Reboot now
Reboot RequiredUSPTD driver will be installed for this device.
Reboot Sekarang
Recent Files
Recently Used Images
Recently Used Images	File name
Recently used images list
Recommencer pour recommencer ou,
Recommended by %s2Google Toolbar makes web browsing more convenient:
Recordable:
Rect
Rect=1044
Redenumire :
re fjerningen av 
Refresh
Re&fresh
Refresh Devices9Display program information, version number and copyright
Refreshing
Refreshing devices$You need to have at least one drive.
Register
Registering: 
Registry access error.
regsvr32.exe /s /u "
Reimenuj:
Reinciar ara
Reiniciar agora
Reiniciar ahora
Reinstall %s
"Reintentar" para intentalo de novo ou
Reintentar para intentarlo de nuevo, o
Reintentar per tornar a provar, o 
Rejected
Rejected Activations
Related news
Related reviews
&Rematar
Remember password
Remote Devices
Remove
Remove all1Select VHD you want to make accessible via iSCSI:
Remove All iSCSI Targets*Do you really want to unmount all targets?
Remove%Are you sure you want to clear items?
RemoveCommonComp
Remove Device
Remove Drive
RemoveFileAssociations
&Remove Image
Remove iSCSI Target
Remove Item(s)
R&emove Orphaned Images
Remove Orphaned Images
Remove orphaned imagesYAsk confirmation before deleting all orphaned images (images with non-existent file path)	Hide CD-R
&Remove Virtual Drive
Remove virtual drive.Ask confirmation when removing a virtual drive
Removing all targets...FYou already have the maximum number of virtual drives on this adapter.#Device has outstanding open handles
Removing target...+Server address format: SERVER NAME [:PORT].5Server with this name is already present in the list.
Removing virtual device
rem v
Rename
Rename: 
Rename Folder
Rename ...	Reset ...
Renombrar:
Renomear:
Renommer : 
Replace
Replace All	Leave All
Reporne
 repornesc manual mai t
 reporni
REQ_SAVE
Request time out.#Server request failed. Error code: 
rer 
rer avinstallasjon av 
Resend Activation Mail
&Reset
&Reset Button Image
Reset to Default
RESIZETOFIT
restart
 restartov
 restartovat?
Restartovat nyn
Restartovat pozd
Restartuj odmah
Restartuj poslije
Restore Default &Layout!&Save Current Layout as Preferred
&Restore Preferred Layout
Result failed/There is no plugin to write image of this type. Source image's invalid password.-Source image file is invalid or unaccessible.
Retries on bad blocks
Retry
Retry/Re
Retry to try again, or
Reviews
Revision
Revocare
Revoke
Revoked
r for 
r for at lukke denne guide.
r guiden kommer v
rhat
Riavvia ora
RichEd20
RichEd32
RichEdit
RichEdit20A
Right
RIGHT
Right=109
Right=315
rii 
Rinomina:
ri peste acest fi
Riprova per tentare di nuovo, oppure
rjon, am
rken l
rma 
rma i
rman
rma Sihirbaz
RMPS	Hide CD-R
Rodyti &detales
Role
ROOT
rova
rovanie zlyhalo
rovat podrobnosti do schr
Rozpakowanie:
Rozpakowanie: b
Rss is empty
rstart
rtot, lai m
rtraukt, lai atceltu instal
rtu 
 rug
ruji do 
&Run $(^NameDA)
runtime error 
Runtime Error!
RWindows Gadget for quick access to main DAEMON Tools functionalities from Desktop.
rziu
%s Adapter
%s adapter is not supported.
Sadece DAEMON Tools Lite kur
SafeDisc
sakor:
Salin Detail ke Klipboard
Salin ke
Sam uruchomi
s ar 
sa sikeres.
sa tart.
Saturday
Save...
Save As...
Save as default device on mount
Save credentials9Unable to save license data file. Please contact support.4
Save image
Save new version setup file
Save Project
Save Project As
Save Project to Image
Save to Image...
Saving to ISO
Saya akan mereboot secara manual nanti
s bude vies
&Schlie
%s Core Files*Please choose the License type you prefer.
SCSI
s de la desinstal
%s (%d items)
 se 
Search for:
Search from any website
&Search Images
Search Images
Search Images...
Searching: %s	Found: %d!Please select folder(s) to search4Please select at least one image file type to search
Sector:
Sectors:
Security6This information will help us to improve DAEMON Tools.,Make new disc (current data will be erased).6Continue disc (current data will be kept on the disc).
SecuROM	LaserLock
 se d
SeDebugPrivilege
\seed.txt
&Seg
&Seguinte >
s el
Selamat datang di Wizard Uninstal 
Select
Select All
Select computer
Selected file does not exist
Select Folder
Select Image Catalog Folder
Select image file
Selection color:
Select new image file
Select server
Select storage type$Specified target name already exists
Select the type of install:
Select your action.3An older version of %s is installed on your system.3The same version of %s is installed on your system.DSelect the operation you want to perform and click Next to continue.
&Selesai
 selhalo
Send anonymous usage statistics
Send feedback
Sending request
 sendo desinstalado.
Send OPC
 sent desinstal
September
Serial number:
Serial Number:&Please enter your valid email address.
Server
Server:
Servers
Server version is unsupported.1Logon failure: unknown user name or bad password.
Service internal error.
Service Pack 
SeShutdownPrivilege
Session
SeSystemEnvironmentPrivilege
Set additional options
&Set Authentication
Set device parameters	File name
Set number of devices
#Set %s home page for your browsers.
settings
Settings
[Settings]
\settings.ini
 Setup
-Setup
Setup 
Setup Downloader
SetupHelper.exe
Setup Helper Process
SetupHlp.dll
Setup operation was cancelled.
 setupprogrammet?
%Setup was not completed successfully.&Completing the $(^NameDA) Setup WizardS$(^NameDA) has been installed on your computer.
Setup will install $(^NameDA) in the following folder. To install in a different folder, click Browse button and select another folder. $_CLICK
Seu computador deve ser reiniciado para completar a desinstala
&Seuraava >
s gombra a f
s gombra a telep
shared
Shared Image Catalog
Shared through
Share".NET Framework %s is not installeddDo you want to download .NET Framework from Microsoft
Share Through iSCSI
shell32.dll
Shell integration...>Wrong split size value. Split size cannot be less than 100 Mb.TCannot open device exclusively. Do you want to open device without exclusive rights?)Select items for context menu in Explorer/Source and destination files cannot be the same5Image with this name already exists in image catalog.EYou need local administrator privileges to run %s for the first time.
s: hiba a f
%s home page
Shortcut currently used by:
show
Show accelerator:
Show by double click
Sh&ow CD-R
Show &details
/showgui
(Show/hide DAEMON Tools Lite main window:
Show/hide panels
Show list as
Show menu:
Show only selected item's info
Show screen tips on menus
Show screen tips on toolbars!Show shortcut keys in screen tips
Show text in toolbar
shoz kattintson a Tov
shoz, vagy
s ide
&Siguiente >
si hiba! Tal
Silahkan tunggu selagi 
SING error
Single converting
sinstall
sinstallation
sinstallation de 
sinstalle.
sinstaller
Si prega di attendere mentre 
%s is already started.
%s is installed on your system.	%s search.Set %s engine as your default search provider.=Get easy access to essential services via %s browser toolbar.
Size
Size:
Size == 0.
Skat
Skin:
Skins
Skipped: 
skleid
Skopiuj szczeg
s le
%s License
 slo
Slots
Slutf
 Slutf
&Slutf
S:(ML;;NW;;;LW)
s most
%s needs to be reactivated as your system configuration has been changed.
%s needs to be validated once to ensure your software is properly licensed. Note that Internet connection is required during validation.
s norite perkrauti j
%s (not found in %s)GCannot delete image. It may be mounted or used  by another application.4Do you really want to delete all nonexistent images?
SOFTWARE\128r95e71b23o59o10t00
Software\Digital River\SoftwarePassport\
Software\Disc Soft\Astroburn Toolbar
Software\Disc Soft\DAEMON Tools Pro
Software\Disc Soft\DAEMON Tools Pro\Data
Software\Disc Soft\DAEMON Tools Pro\View
Software\Disc Soft\DAEMON Tools Toolbar
Software\Microsoft\Windows\CurrentVersion
SOFTWARE\Microsoft\Windows\CurrentVersion\App Paths\DTLite.exe
Software\Microsoft\Windows\CurrentVersion\Explorer\FileExts\.
Software\Microsoft\Windows\CurrentVersion\Explorer\MenuOrder\Start Menu2\Programs\DAEMON Tools Lite
Software\Microsoft\Windows\CurrentVersion\Run
SOFTWARE\Microsoft\Windows\CurrentVersion\Run
SOFTWARE\Microsoft\Windows\CurrentVersion\RunOnce
Software\Microsoft\Windows\CurrentVersion\Uninstall\DAEMON Tools Lite
Software\Microsoft\Windows\ShellNoRoam\MUICache
Software\Yandex\Downloader
Some application files or components are currently locked by another processes. Please close the following applications to continue uninstall:	End Tasks
Some files needed for setup are currently in use. Please close folowing applications:
Some files were not added
+Some files were not added. Continue anyway?
%s online.
Sort By	Ascending
 souboru.
 souboru pro z
Source
Source:
Source device:
Source file name:
Source folder:
Source image contains information about disc structure. This information will be lost after saving. Are you sure you want to save changes?"Verification was cancelled by user
Source image password::Destination file name is not valid. Specify file's folder.-Source or destination file name is not valid.
Source media is unsupported.!Media has no complete session(s)."Insufficient memory for operation.
Source Name
< &Sp
Space available: 
Space required: 
 spauskite 
, spauskite 
Specify VHD properties
speed - 
Speed
Speed:
Speed: %dKBs
Spiediet P
Spiediet Pabeigt lai aizv
Split file
Split file:
Split Size:!Ignore error and generate content,Ignore error and add sector to bad block map
Spou
s povede odinstalac
Spracova
 sprievodcovi odin
SPTD driver is not installedKInitialization failed. Reinstalling the application may solve this problem.
\SPTDinst-x64.exe
\SPTDinst-x64.exe->
\SPTDinst-x86.exe
\SPTDinst-x86.exe->
SPTDPSCSI Pass Through Direct (SPTD) layer is needed for Advanced Emulation features.
SPTD Version:hThis program requires at least Windows 2000 with SPTD %s or higher.
 spu
sra val
sre a var
%s (%s)
%s: %s
%s Server:
%s Service is disabled!
%s Service is not running
s sikertelen
s sikertelen:
%s\%s "%s"
%s switch syntax error.
sta>
sta f
Standard
Standard Edition
Standard ISO
Standard ISO Image (*.iso)
Standard ISO images
 sta per essere disinstallato.
s tard
s tarde
Start
Starta om nu
Start Burn	Browse...
Start burning
Started disc imaging for drive
 startes p
Starting %s adapter
Start Menu Shortcuts"The core files required to use %s.
Start p
Start sector:
Start verification
Start working.Use this button to add images to Image Catalog
State
State:	Locality:
Static
STATIC
 stato disinstallato dal tuo computer.
Status:
&Status Bar
Status Details
Status	System ID	Client IP
ste >
ste for at forts
ster
ste startas om f
sti, spauskite 
%s toolbar Create file associations for %s.
Stop
Stopped
 stoppe installasjonen,
Stopping %s adapter
Stop virtual adapter.Ask confirmation when stopping virtual adapter
Storage type
Storno
StringFileInfo
strojovou li
stup k
stupn
Sub-channels:
	Succeeded
success
Success(DAEMON Tools Net Service internal error.
successful
Such boot image type isn't supported in current version. Bootable information will be lost in saved image. Do you want to continue?	Verifying
Such image is already mounted
su datora.
su dators ir j
suffix: %s
Suiva&nt >
S&ulje
Sunday
Suorita:
Supported audio filesbISO9660 file system doesn't support files larger than 2Gb. Erase this disc or insert an empty one.
Supported OS versions:
Supported Read Features
Supported Read Modes
Supported Write Features
Supported Write Modes
&Support Request
Support Request
Sveiki atvyk
%s was activated successfully.
Switch All
Switch to Astroburn Wizard mode Switch to classic Astroburn mode
Switch to New mode
sync
SysListView32
\System.dll
System ID:
System ID was changed
 szczeg
sz&letek
 ta en omstart n
tails
tails dans le presse papier
< &Takaisin
Tallennuskansio:
talova
talovan
talovanie
&Tamamla
 Tamamlan
Tamamland
Tam kurulum (tavsiye edilen)
tan ba
&Tancar
tani a g
tani a sz
tani most?
 tardi
Target alias:
Target Alias
Target device:
Target name:
Target Name
Target name has invalid format.
)Target operating system is not supported.KCannot perform operation while application is running on the target system.!Enter computer name or IP address
Targets:
tartova
tartovan
Task
Tasks Panel
t Deta
t &detaliz
te, 
te acum
tejte v Pr
 telah dihapus dari komputer anda.
 Telep
\Temp
TEMP
templ: %s
Temporary file name:
te na Dokon
te na P
 ten plik.
Tento pr
Tento sprievodca V
tepta
 teraz
 teraz?
ter l'installation,
&Termina
&Terminar
Terminare
Terminer
ter selber einen Neustart durchf
< &Terug
Tervetuloa 
te s
 te voltooien. Wilt u nu opnieuw opstarten?
TEXT
&Text Only (Always)
Text &Only (In Menus)
tfen 
tfen bekleyiniz.
t gombra az 
Thank you for trying %s!
The application is corrupted.
The disc is empty	Language:
The disc is finalized
The disc is not inserted.
The disc is not writable.
The file name is not validCImage file creation error: make sure you have available disk space.	Cancelled"The directory could not be deleted
The file "%s" is not signed.
The file "%s" is signed and the signature was verified.
The network path was not found.
The project is empty
There are no virtual devices.
The signature is present, but not trusted.
The signature is present, but specifically disallowed.
The size of this virtual hard disk expands to a fixed maximum size as data is saved to it. The disk size does not compact automatically when data is deleted.
The software license was blocked.
The virtual hard disk uses a fixed amount of space regardless of the amount of the data stored on it. Its default size is the maximum amount of space available on your physical hard disk.
This indicates a bug in your application.
This indicates a bug in your application. It is most likely the result of calling an MSIL-compiled (/clr) function from a native constructor or from DllMain.
This is not free software.
This Operating System is not supported.
This operation requires system reboot!
This option has no effect on other media so normally it is safe to have it enabled permanently.
This option is obsolete and should be used by experienced users in case it is absolutely necessary only.
This option is obsolete and should be used by experienced users only if absolutely necessary.
This software is only for the purpose of legal use of duplication under the current copyright laws. Any duplication without permission by copyright owners is illegal under the current copyright laws. Users are liable for criminal and civil penalty under the current law for illegal duplication.
This wizard will guide you through the uninstallation of 
Thursday
Tidak bisa menulis:
 &tiedot
 tietokoneeltasi.
 tietokoneen my
Tietokoneesi on k
 tika atinstal
< &Tilbage
< &Tilbake
Tiles
Tile Windows Horizontally
Tile Windows Vertically
Tilpasset
Time
Time elapsed:&No disc inserted into selected device.
Time left:
ti perkrautas prie
Title
Title:
t, lai izlaistu failu.
TLOSS error
tnevez
Toliau
&Toliau >
Toolbar
&Toolbar
Toolbars
&Tools
Top=0
Top=10
tor 
tor?
Total:
Total data burned:
Total files count:
Total folders count:
&Tov
t! Poru
Track
Track:
Track at Once
Track %d burning
Track %d verifying
Track reading$Operation failed. Cancelled by user.
Tracks:
Tracks count:
Track type:
Translate web pages instantly"Auto-fill web forms with one click-Install the free Google Toolbar along with %s$You can remove it easily at any time
Translation
TRANSPARENT
 travers la proc
trehoz
tre red
-trial
Trial License
Trial period:
[Trial period: %d day(s) left]
Trial period has expired.
Trial period will expire in %d day(s).
, trwa usuwanie programu 
Tryck Avbryt f
Tryck p
try %d
Tryk annuller for at stoppe installationen,Fors
Tryk Fuldf
Tryk N
Try later
Try Later
	Try LaterFYour license is not verified.
Try to check partner params...
Try to run: %s %s
ts instal
ts no J
tta.
t tagad
t tagad?
tte.
tt gy
Tuesday
turulamad
&Tutup
tu v
tu Yandex.Bar v barv
t uz
TxtColor
Type
TYPE
Type=bitmap
Type=label
Type of emulation:
ty z Twojego komputera.
(&U)
Ubah nama:
U computer moet opnieuw worden gestart om de uninstallatie van 
Udpak:
Udpak: kunne ikke skrive til filen
u_.exe
u_.exe" 
uIt is impossible to use these files in ISO9660. Some files' size is more than 4Gb. Use UDF format to burn such files.ySome files have more than 2Gb size. Not all of the OS'es can process the files correctly. Do you want to continue anyway?
Uitpakken:
Uitpakken: Fout bij het schrijven naar bestand
Uitvoeren:
Uitvoer map:
ujem 
ujem sprievodcu odin
ujte kliknut
 uklanja.
 Uklanjanje
&Uklanjanje
Uklanjanje 
Uklanjanje programa u tijeku
&Ukloni
Uknjanjanje
Ulangi untuk mencoba lagi, atau
Umbenennen: 
umemoriju
una bas
una basabilirsiniz.
Unable to access image file.
"Unable to access sub-channel file.
Unable to add adapter.
Unable to add virtual device.
Unable to burn this image file.
-Unable to change permissions for some images.1Unable to change permissions for selected images.CCannot burn specified image with RMPS data. Please contact support.
Unable to connect."Check computer name or IP address.'Operation failed. Internal setup error.
Unable to create new image.
Unable to initialize DAEMON Tools Lite setup plugin.
- unable to initialize heap
Unable to initialize %s setup.8You must restart your computer after previous operation.OSetup file has invalid name. Make sure the distribution files were not renamed.'Another %s installation is in progress.(You need local administrator privileges.
Unable to mount image.
- unable to open console device
Unable to remove adapter.
Unable to save file: 
Unable to unmount image.
:Unable to write file which has more then 4GB size to FAT32
unala.
unalnika.
unalnik ponovno zagnati zdaj?
unalnik se mora ponovno zagnati 
unalo
unalo?
unalo mora biti ponovno pokrenuto kako biste zavr
unara.
unar mora biti restartovan da bi se uklanjanje 
unar se mora ponovo pokrenuti da biste zavr
undan emin olunuz.
Une erreur de d
Une erreur est survenue lors de l'
Une erreur est survenue lors de la cr
- unexpected heap error
- unexpected multithread lock error
Unfortunately, activation period for this software license expired.
Unfortunately, upgrade period for your software license expired. Prolong the period of Free Upgrades to install the new software version.
UNICODE
&Uninstal
Uninstal 
Uninstall
 Uninstall
&Uninstall
UninstallFinishPageFree
UninstallFinishPageInit
Uninstalling
Uninstalling2Please wait while $(^NameDA) is being uninstalled.
Uninstalling %s.Setup was unable to remove older version of %s
 Uninstall Wizard
\uninst.exe
UninstHlp
\UninstHlp.dll
Unit:
Unknown
Unknown error.
Unknown file system
Unknown switch in command line..Second quote not found in command line switch. Command line switch is too long.
Unmount
&Unmount	&About...
Unmount all:
Unmount All5Ask confirmation before unmounting all virtual drives
U&nmount All Drives
Unmount All Drives
Unmount Image
Unmounting all drives
Unmounting image
Unmounting images
Unpaid
UnpinProgram
Unprotected Audio Disc.
Unprotected DVD-Audio.#DVD Video disk with CSS protection.)Old SafeDisc protection with bad sectors..SafeDisc protection with bad and weak sectors.;New SafeDisc protection with bad and enhanced weak sectors.&Protection based on physical topology.&Protection based on physical topology.&Protection based on physical topology.EProtection based on sub-channel data. Old version, under version 4.8.&Protection based on physical topology.!Protection based on twin sectors.
Unprotected DVD-Video.
Unselect
Unselect All
Unshare
Unvalidated license
(unvalidated)!Please enter valid Serial Number.
update
Update
Update all
Update license
Update to %s
Updating
Updating virtual devices
 upis:
url: %s
Uruchamianie:
Use custom colors
Used:
Used space
Used space:
Use existing folder
Use only if it is absolutely necessary.
use proxy
Use proxy server
user
user32::PostMessageA(i,i,i,i) i(-1,
user32::RegisterWindowMessage(t r0) i .r1
UserChoice
\UserChoice
User images
User interface language
User name:
User registration failed.
users
Use specific rights
Use system colors
Use tray agent
uspremnik
 usuni
Usuwanie
Usuwanie 
UTF-16LE
UTF-8
 uudelleen:
 uudelleen jotta 
 uudelleen' tai 
%u.%u%s%s
 uygulamas
 va ghida 
. Vai v
Val: %d
Validate
ValidateText
Valitse 'Keskeyt
Valitse 'Seuraava' jatkaaksesi.
Valitse 'Viimeistele' sulkeaksesi t
Valmis
Value
 Var
VarFileInfo
Var v
 vedl
 ve favori servislerinize h
ve igen, ellerIgnorer for at springe over filen.
ve igjen, eller
vel escrever em:
Velkommen til 
Velkommen til veiviseren for avinstallasjon av 
Vendor
Vendor identification:
Vennligst vent mens 
Vent venligst mens 
 ver
Veri 
Verification error
Verification successful
Verify
verifying installer: %d%%
ver: %s
Version
Version:
&Verwijderen
 ve servislerini kur
vesties aplankas:
Veuillez patientez le temps que 
VHD path	VHD path:
VHD sizing type
&View
View all games
View All Games
View All News
View virtual device properties&Mount image to selected virtual device*Unmount image from selected virtual device
&Viimeistele
. Vil du genstarte nu?
. Vill du starta om nu?
Virhe avattaessa tiedostoa kirjoitusta varten: 
Virhe luotaessa:
Virhe purettaessa dataa! Vioittunut asennusohjelma?
Virtual Adapters Management
Virtual CD/DVD Devices
Virtual CD/DVD ROM
Virtual device
Virtual device info
&Virtual Device Manager...
Virtual Device Manager
Virtual device media info9Specified folder doesn't exist. Do you want to create it?ECannot delete image. It may be mounted or used by another application
Virtual Devices
Virtual hard disk
Virtual Hard Disk
Virtual hard disk mount(Specify properties for virtual hard disk6CHAP authentication failed. Unable to get target info.
Virtual optical device
Virtual optical device mount%Specify properties for virtual device
Visa &detaljer
Vis &detaljer
Visit the %s Home Page+A newer version of %s is already installed.IDebugger was detected. Please run the setup application without debugger.
< &Vissza
Vitajte v 
Vlastito
Vlastn
VLINE
vodce.
vodce v
vodci odinstalace 
Voglio riavviare manualmente pi
VolatileTest
&Volgende >
. Vols reiniciar ara?
Voltooien van de 
Volume file size:
Volume Label
Votre ordinateur doit 
. Voulez vous red
VSCROLL
VS_VERSION_INFO
Vull reiniciar manualment m
. Vuoi riavviare ora?
Vykdoma:
w, aby spr
Waiting for installing...
Waiting timeout was exceeded..The same product version is already installed.
WANTRETURN
WARN_IF_EXIST
Warning
Warten Sie bitte w
Waveform Audio File Format
W celu doko
We appreciate your understanding.
Wednesday
&Weiter >
Welcome to the 
Welcome to the %s Setup Wizard&Are you sure you want to uninstall %s?
Welkom bij de 
Wiederholen, um es nocheinmal zu versuchen, oder
Willkommen beim 
&Window
Windows Gadget
Windows Media Audio
\Windows Sidebar\sidebar.exe
Windows XP 32/64-bit (since SP2), Windows Server 2003 32/64-bit, Windows Vista 32/64-bit, Windows 7 32/64-bit, Windows Server 2008 (incl. R2)
\wininit.ini
Witaj w kreatorze usuwania programu 
Wizard Home"Yes, I want to erase inserted disc.Change settings that are currently unavailable
Wizard ini akan menuntun anda untuk menghapus 
Would you like to create an image using APE format?
Would you like to create an image using MDX format?4
Write Mode:
Write speed:
Writing image file
Wrong type.
W\SetupHelper.exe
< Wstecz
 wurde von Ihrem Computer deinstalliert.
WUSER32.DLL
ximo >
ximo para continuar.
Yande
Yandex
Yandex aramay
Yandex.Bar 
Yandex.Bar v barv
YandexPackSetup.exe
YandexSearch.exe
YBar don't need.
y do schowka
Yeniden Adland
Yeniden ba
Yeniden denemek i
&Yes
yla kald
ymui: 
ynnist
ynnistett
yor:
)You are going to activate a Paid License.
You can buy full %s license now or continue program evaluation.
!You can't burn to finalized disc.
You can't burn to locked disc.
You have to buy a license or activate the Trial version.
You have to revoke activated instance at %s page to activate the program on this system.
You have to revoke at least one activated instance at %s page to activate the program on this system.
You have tried to activate the software license with invalid Serial number. Please check the license data at %s page and try again.
>You need to have at least one DT drive to connect iSCSI TargetLVirtual device cannot be shared through iSCSI and connected at the same time1Virtual device already connected to iSCSI target.
Your computer must be restarted in order to complete the uninstallation of 
Your license is not validated on our server.
Your mount statistics will be sent to %s anonymously and combine with hundreds of other anonymous users. Any identifiable information about you won't be collected and shared.+Don't allow MountSpace to use my statistics
You will be able to mount the files via double click in Windows Explorer.
'Yrit
yti:
ytkownika
 za 
Zaklju
Zako
Za&ko
Zamknij
Zanemari kako biste presko
Zanim zaczniesz upewnij si
&Zapri
&Zatvori
&Zav
 zavr
Zavr
&Zavr
Za zatvaranje pritisnite dugme Zavr
zdan ba
zdan kald
Zielverzeichnis: 
Zmiana nazwy:
Zobrazi
z oldu
 zosta
< &Zp
Zrestartuj teraz
< &Zur
 z V
^^^^^^^^^^^^
<>>><>
===========^
                          
 )%''"
 @@@@@@@@@@@@@@@@+
 *),'%
 %**&-,*%
;==!!<
: :@:`:|:
:;===!!<
:;==!!<
:;;===!!<
"""   """
"""""/
"""""'
""""""
""""""""
""""""#
( #...$
((-/--
@@@@@@@
@@@@@@@@@
@@@@@@@@@@@
@@@@@@@@@@@@@@@@@+
@@@@@@@@@@@@@+
@@@@@@@@@@@@$
@@@@@+		$
@@@@@+		$+
@@@@@+		$+((
@@@@@+		$+((.
$(-/-&'
$$$((((**%
**&-,*%
#(.---
#@@@@@@@@@@@@@
#@@@@@@@@@@@@@@@@@@@@@(
###!!!!!!   !!!###!!!
%:;==>>><>
%%*'!-,*%
%%**&-,*%
%%**&-,&
%%**&-'*%
%%**&%,*%
%%%)&-,*%
+@@@@@
+@@@@@@@@@@@@@@@@@@@@+
	,/(....
	,/(.....
	,/(..+
( #...0(
(.0//--
@@@@@+		$+((.0+
*///0//--
*//0//--
+((..0
	,/(.....0
	,/(.....0.
( #...00(
(...00
(...00/
$+.00(.
$+.00+.
+((..00
	,/(.....00#
$+.000(.
	,/(.....000
	,/(.....000-
 (...0000(.
 +....0000(.
(......0000(.
(.....0000(.
(..0000(.
$.0000+.
$+...0000(.
$+..0000(.
#+.0000(.
+.....0000(.
 +.00000+.
-0.....0000(.
/0.....0000(.
$+00000+.
 +.000000+.
$.000000+.
 /......0000000+.
 +...0000000+.
......0000000+.
..0000000+.
.0000000+.
(..0000000+.
(.0000000+.
(+...0000000+.
(+..0000000+.
$.....0000000+.
$.0000000+.
$+..0000000+.
$+.0000000+.
#+.0000000+.
+....0000000+.
+...0000000+.
+..0000000+.
++...0000000+.
++..0000000+.
0 0$0(0,0004080<0@0D0H0L0P0T0X0\0`0d0h0l0p0t0x0|0
0$0,00080@0H0\0d0h0p0x0
0 0(00080@0H0P0X0`0h0p0x0
 .000033333--
 +..000033333--
 ++..000033333--
.000033333--
(.000033333--
#..000033333--
#.000033333--
#+..000033333--
#++...000033333--
+..000033333--
+.000033333--
+000033333--
0$0(0,040L0\0`0h0
0 0<0@0D0\0
000@0D0T0X0\0d0|0
$000?0J0
000111
	,/(.....0003
	,/(.....0003*
	,/(.....00033
	,/(.....00033"
	,/(.....000333
.00033333--
(.00033333--
(00033333--
$.00033333--
#.00033333--
	,/(.....000336'
	,/(.....0003366
	,/(.....0003366,
	,/(.....00033666"
	,/(.....00033668:::1
	,-#(+++.00033668::;;;;;<79
	,/(.....00033668::;;;;;<79
	,/(+....00033668::;;;;;<79
	,/(.....000336688
	,/(.....0003366888"
	,/(.....00033668::::94
	,/(.....00033668::;;;;;959
	,/(.....00033668::;;;;9745
0$0,040<0D0L0T0\0d0
000:::888:::888111SSS
(0/0;0A0M0S0\0b0k0w0}0
0%0:0C0P0x0~0
0 0+0E0P0X0h0n0
0$0+0H0
000P0d0p0x0
0'0<0Y0c0x0
00161H1v1
0 020O0i0{0
( #...003
(...003 
+((..003
( #...0033
(...0033
(...0033*
+((..0033
+((..00332
( #...00333
.0033333--
(00/33333-'*
(0033333--
$.0033333--
#0033333--
+0033333--
0033333--
( #...00336,
(...00336
(...00336,
+((..00336,
( #...003366
(...003366
( #...0033666
(...0033666
( #...0033668::
( #...0033668::;;
( #...0033668::;;==;
( #...0033668::;;;,
( #...0033668:::
(...0033668::
(...0033668::;;===!
(...0033668::;;===!!<
(...0033668::;;;;&
(...0033668:::%
(...0033668:"
(...0033668*
$++.0033668::;;===!!<
( #...00336681
(...0033668:::;1
( #...0033668::;;==>><4>
( #+..0033668::;;==>><4>
(+.0033668::;;==>><4>
( #...0033668::;;====7
$(+.0033668::;;;;;<79
( #...00336688
#(.003368::;;==>>><>
+((..003368
+((..003368::
+((..003368::;;==
+((..003368::;;==>>=&!
+((..003368::;;==>>><>
+((..003368:::
+$(..003368::;;==>>><>
+((..003368::;5
+((..003368::;;===5
+((..0033688
+((..003368::;;9
+((..003368::;;==>>>9<
0#040=0T0g0q0
0#060I0[0
@@@@@@@@@@@@00db
0(0H0P0\0|0
]0}0m1
0#0Q0p0|0
0"0t0z0
0#111>1]1
0/1?1M1
0/1<1Q1
0/--12,!
0/--12%
0123456789abcdef
0123456789abcdefABCDEF
0123456789abcdefghijklmnopqrstuvwxyz
 !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~
 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~
 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~
0/--12,!9
0/--12,!99
0/--12,!99<<>>
0/--12,!99<)!>
0/--12,!99<<7)
0!1a1g1
0^2k2y2
@@@@@+		$+((.03/
030Q0X0\0`0d0h0l0p0t0
031204000000Z
@@@@@+		$+((.0333
#+0/333--
 (.033333--
(0/33333-'*
$.033333--
 0/333333-'*
.0/333333-'*
(.0333333-'*
(0/333333-'*
$.0333333-'*
$0/333333-'*
#(++.03336688:::;;;5;
@@@@@+		$+((.0336-
@@@@@+		$+((.03366-
@@@@@+		$+((.033668:
@@@@@+		$+((.033668:;;
@@@@@+		$+((.033668:;;=
@@@@@+		$+((.033668:;;==,
@@@@@+		$+((.033668:;;=>=>
@@@@@+		$+((.033668:;;=>=>><<)
@@@@@+		$+((.033668::
@@@@@+		$+((.033668%
$(+.033668::;;===!!<
$+033668::;;===!!<
 (.033668::;;==>><4>
@@@@@+		$+((.033668:;;=>=>><=4
@@@@@+		$+((.033668:;;=>=>>4!)
@@@@@+		#(#(.033668:;;=>=>><=4
#+033668:;;=>=>><=4
$(033668::;;;;;<79
$+.033668::;;;;;<79
(0336688:::;;;5;
$.0336688:::;;;5;
#(+.03366888::::58
$.03368::;;==>>><>
#(0/366888::::58
0_3c3g3k3o3s3w3{3!4
04080<0
040O0Z0e0s0
> >$>(>,>0>4>8><>@>D>H>L>P>T>X>
= =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=
> >(>,>0>4>8><>@>D>H>L>X>
?(?,?0?4?8?<?@?P?
{06='=
061A1\1c1h1l1p1
070615000000Z
&080O0(3.3X3^3
081?1L1R1
081P1y122:2K2W2o2
= =$=(=,=0=8=<=`=d=h=l=p=t=x=|=
> >(>0>8>@>H>P>X>`>h>p>x>
? ?(?0?8?@?H?P?X?`?h?p?x?
> >(>0>8>@>H>T>t>|>
090521000000Z
091104000000Z
0A@@Ju
?0?<?d?x?
<'<0<;<G<L<\<a<g<m<
;(;0;`;h;l;
:*;0;h;o;
0http://crl.verisign.com/ThawteTimestampingCA.crl0
`0!Ip.
>,>0>L>P>p>
=0=P=p=
0rJw1}
0SSSSS
|0TM)/f
;0<U<c<h<m<
0WWWWW
[0Y0W0U
1;==>>><>
100205000000Z
11((++++.003336688:::;;;5;
1"101[1g1u1
1&101B1T1f1
1(101X1p1
1-1($((++..033366888::::58
110413100000Z
 )",111,$###$
111///
1 1(10181@1H1P1X1`1p1
1"1(1-1:1L1
1$1,141@1x1
1 1$14181<1D1\1l1p1
1"1C1H1n1
1$1D1L1X1x1
1:1H1V1f1x1
1[1k1{1
1$1Q1^1l1s1{1
1*1Y1v1
12/....
12/.....
12/......
12/.......
12/..$
12/......0
12/......00
12/......00/
12/......000
12/......000336688:::;;;5;
12/......003
12/......003(
12/......003- 1688:::;;;5;
12/......0033
12/......0033$
12/......0033*
12/......0033+
12/......00333
12/......00333 
12/......00333 188:::;;;5;
12/......003333
12/......003333188:::;;;5;
12/......003333-88:::;;;5;
12/......003336'
12/......003336188:::;;;5;
12/......0033362
12/......00333662
12/......003336662
12/......003336688:::;;;5;
12/......003336688::::::5:
12/......0033366885%
12.+++...003336688:::;;;5;
12/......003336688:::::8,1
12/......0033366888851
12/......00/336688:::;;;5;
12/......00/+36688:::;;;5;
12/......00+-36688:::;;;5;
12/......00++36688:::;;;5;
12/......00##/6688:::;;;5;
120117133249Z0#
1,2024282<2@2D2H2L2P2T2X2
120501000000Z
120529175202Z
120614235959Z0\1
121018000000Z
121018044448Z0#
121103235959Z0
121221000000Z
121231235959Z0b1
121f1w1
%12%2%
	"122"
%1222,%
%1222'
%1222,%2
12222,
1,%22222,
%1222,%22""2,
%1222,%222-*,
12,%22222,
%1222,%22222,
%1222,%22222&
%12%26,
%12%26661"2666,126"
%12%266661
%12%266666*
%12%26666661
%12%266*"66666,126"
%12%266666666
%12%2666666666
%12%2666666666,""1"
%12%2666666666,11*"
%12%2666666666,126"
,122+((((((((#(+-666888852
1*232;2`2
-,126"
1260... 
1260......
1260...... 
1260.......
1260......(
1260......#
1260.....#
1260....(
1260.+
1260......0
1260......0 
1260......00
1260......00/
1260......00(
1260......000
1260......003
1260......003/
1260......003*
1260......0033/
1260......0033'
1260......0033+
1260......00333#
1260......00333-1688::::58
1260......003333
1260......0033331
1260......00333322'
1260......00333366652'
1260......0033336688::::58
1260......00333666666522,*
1260......00333--688::::58
1260......00//336688::::58
1260.......00/3366888:::55
1260+++++..00/336888::::58
1260........03366888::::58
1260........0/366888::::58
1260......((+/366888::::58
1260......+(./366888::::58
	"12662
%126666
	"126666'
%1266666
	"1266666%
%12666666
%126666662
	"126666666
	"126666666,
%1266666661"2666666626
	"1266666666
%12%"'66666666,126"
	"12666666662"6666333/0//--
%1266666666*'266666626
	"12666666666
	"126666666661"266333/0//--
%126666666666
	"126666666666
	"126666666666,
%1266666666666
	"1266666666666
	"1266666666666,
%12666666666666
	"12666666666666
%126666666666662
	"126666666666662
	"12666666 "666666333/0//--
	"126666666666666'
%1266666666666666
	"1266666666666666#
	"12666666666666663"
	"126666666666666633+
	"1266666666666666333/+
	"1266666666666666333/0//--
	"1266666666666666333/0/(
%12666666666666666-
%12666 '66666666666626
%12666666666"-66666626
%1266666666666666666''
%126666666666666666626
1&272G2M2Y2
.---12,!99<<>>
.(--12,!99<<>>
*12,!99<<>>
1-2Q2X<
130204235959Z0
130314082331Z0#
131203235959Z0S1
1}3]4&5W5m5
1;=>=4)>4
14919ea49a8f3b4aa3cf1058d9a64cec
150530175202Z0
:,:1:6:
162,&5
 ,,1660((($$ 
"'-166/......000033333--
 1666-
166,&6
166626
166630.....0000(.
1666333/0//--
1666626
1666630.....0000(.
16666,&6
1666662,6
16666662,6
166666666626
16666666666666626
166666666666666662,6
1688::::58
1;;<79
18:;;==>><4>
18::;;==>><4>
18::;;;;;<79
 188852
,1,9<>>!
190413100000Z0Q1
190520235959Z0
19659239224e364682fa4baf72c53ea4
;%<1<==e=s=y=
'1FH<m
1 ~)hh[
_1,MNv|
}$|1o>%
1p4t4x4|4
1p]RER. y
1#QNAN
1#SNAN
='=,=1=U=
%|1wdBJ
=&>1>X>u?
1Y1_1e1k1u1{1
2:;;==>>><>
2::;;===!!<
2.,$! 
20>0S0c0
201229235959Z0b1
201230235959Z0^1
202<2\2d2l2t2
20T0f0x0
212F2t2
213Q3h3
2&212W2o2u2
#'(,/222,
2$2*21282?2F2M2T2[2c2k2s2
%%22222,
2 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2
2 2$2(2,20242D2H2L2P2T2X2\2h2l2p2t2x2|2
<2"<2#;2";2!:2!:1"<4$;2#90"4+
")222,%22222,
2 2)2/262F2
2 2$2,2D2T2X2h2l2p2t2|2
2#222Z2o2~2
2"2(23292D2J2T2Z2f2m2y2
2$2,242<2D2L2T2\2d2l2t2
2%2*292O2Z2_2j2o2z2
2#2*2C2W2]2f2y2
2$2,2D2P2p2|2
2'2@2J2]2
222M+++
-2251,9<>>!
%22662
%226666
%2266666
%22666661
%226666661"266666626
%226666666,"26666626
%2266666666%'2666626
 *2%2666666666,126"
%22666666666"'266626
%226666666666%"26626
%2266666666666' 1226
%226666666666661
%22""666666666666626
%2266666666666666
%22666666666666666,'
%2266666666666666626
2$282L2`2t2
2:2e2p3z3
2-2J2d2
"230.....0000000+.
2$343:3F3L3\3b3h3w3
2"383f3x3
2:;==>><4>
2:;;==>><4>
[25[ikkkkjkG
 26::;;==>>><>
26,126"
"')26 '266662,&5
26333/0//--
 ,,266/++++($
-2660....
-2660.....
-2660......
-2660...... 
-2660........+--'
-2660........+-//-,,%
-2660........+(
-2660........+#
-2660........++"
-2660......(
-2660......$
-2660......+
-2660.....(
-2660.....$
-2660.....#
-2660..+
-2660.#
-2660......0
-2660......0 
-2660......0.
-2660......0.(
-2660......0.$
-2660......0.#
-2660......0.+
-2660......0.+ 
-2660......0$
-2660.....+((#(+---11111-,
-2660.....(#$$+/3326888852
-2660.....($(+-/3666888852
-2660........((**366888852
-2660..++++.+$(**366888852
266,126"
"')266"%26662,&5
 ,,2663....
 ,,2663.....
 ,,2663......
 ,,2663...... 
 ,,2663.....(
 ,,2663.....#
 ,,2663.....+
 ,,2663....(
 ,,2663....(#
 ,,2663....$
 ,,2663....+(
 ,,2663...$
 ,,2663...#
 ,,2663...+( 
 ,,2663...+++
 ,,2663..+++(
 ,,2663+#
26630.....0000(.
 *&2666- 
'26661
%26661
"')26661"2662,&5
*26662,
*26662"
 *&26663..
 *&26663.. 
 *&26663...
 *&26663... 
 *&26663.....
 *&26663..... 
 *&26663.....$
 *&26663.....#
 *&26663....(
 *&26663....+
 *&26663...+
 *&26663...+(
 *&26663...+#
 *&26663..($$
 *&26663..+(
 *&26663..++
 *&26663..+++ 
 *&26663.+(
 *&26663+(
"')266662
%266662
%,2666630.....0000000+.
'266666'
*266666*
%2666661
"')2666662
*2666662 
'2666666*
*2666666/
*2666666/+
%2666666'
*26666661
*26666663.
*26666663. 
*26666663...
*26666663....
*26666663.....
*26666663......
*26666663.......$
*26666663......+
*26666663.....$
*26666663.....#
*26666663.....+
*26666663....(
*26666663....$
*26666663....+
*26666663...$
*26666663...+
*26666663..$
*26666663..+
*26666663.#
*26666663.+
*26666663......0000/(#
*26666663......000033333--
*26666663.+++..000033333--
*26666663.......00033333--
'26666666"
"')26666666
*26666666*
2666666,&6
266666662,&5
26666666333/0//--
'266666666
'266666666,
"')266666666
*266666666
*266666666*
%266666666
*266666666( .....0000000+.
*266666666*$.....0000000+.
%2666666661"266666662,6
"')2666666662,&,
"')2666666662%
"')2666666662,&5
%)2666666662,&5
2666666662,&5
26666666626
2666666662,6
*2666666663
*2666666663 
*2666666663.
*2666666663+
*26666666630
*26666666630.
*26666666630. 
*26666666630..
*26666666630.. 
*26666666630...
*26666666630....
*26666666630..... 
*26666666630...$
*26666666630..(
*26666666630.(
*26666666630.+
*26666666630$
*26666666630.....0(
*26666666630.....000+ 
*2666666663......0000000+.
*26666666630... .0000000+.
*26666666630.....0000000+.
*26666666630.....0000000++
*26666666630..$ .0000000+.
*26666666630..+ .0000000+.
266666666333/0//--
'2666666666
'2666666666'
266666666,&6
%2666666666,126"
266666666626
%2666666666",26666662,6
'2666666666,-30.....0000(.
'26666666666
'26666666666-
%26666666666
2666666666,&6
'26666666666,-0.....0000(.
'26666666666'/0.....0000(.
%266666666662
2666666666626
266666666662,6
'26666666666*30.....0000(.
'266666666663(0.....0000(.
'26666666666330.....0000(.
'266666666666
'266666666666-
'266666666666/#.....0000(.
'266666666666*$.....0000(.
'266666666666 0.....0000(.
26666666666626
2666666666662,6
%266666666666*"266662,6
'2666666666663
'2666666666663$
'26666666666630
'26666666666630.
'26666666666630..
'26666666666630....#
'26666666666630..+
'26666666666630$
'26666666666630.....0$
'26666666666630.....0000(.
26666666666662,6
%2666666666666""26662,6
266666666666662,6
%26666666666666"'2662,6
%266666666666666""162,6
%2666666666666666,
'266666666666666626
%26666666 ,6666666662,6
%266666666666666666"
 %26666666666666666626
%26666666666666666662",
%26666666666666666662,6
266888852
$2688:::;;;5;
*2688:::;;;5;
26888852
28::;;===!!<
282X2d2
28:;==>!7<>7
'2882;=>=4)>4
288:::;;;5;
2888::::58
*2,!99<<>>
2B7-I@-I>+B7#nfW
	2bPDX
2C2H2i2o2y2
;";-;2;=;C;I;Q;Y;_;e;s;~;
,%2%H+Y
2id/@7
2N2T2c2=3P3
2-n^jx[7:
2p:t:x:|:
2S3^3S4
2Terms of use at https://www.verisign.com/rpa (c)09100.
2UPJodC
2Z2`2d2h2l2
-30.....0000(.
303@3D3L3d3t3x3
303B3T3f3x3
303U3l3!4J5(6
3-121,9<>>!
$(-/33-'*
#(-/33--
%/33/0//--
-330.....0000(.
330.....0000(.
3$30393
3$303x3
3%313<4k4
 $*-33266-
-333/0//--
 (-/3333-'*
 (./3333--
$(/3333-'*
-3333/0//--
 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|3
/33333-'*
$./33333-'*
$$+/33333-'*
$+/33333-'*
#/33333-'*
+/33333-'*
 +/333333-'*
(/333333-'*
$./333333-'*
333333;{
3!3)3/3B3O3w3|3
3 3<3@3H3L3h3
3"3;3@3J3a3f3k3
3$3,343<3D3L3T3\3d3l3t3|3
 /3336666-
/3336666-
(/3336666-
(3336666-
$-3336666-
$/3336666-
#/3336666-
#.3336666-
3"343:3A3R3
334:4s4z4
#(-/33666-
 (-336666-
 (336666-
 336666-
/336666-
#-/336666-
#*336666-
#+/336666-
#336666-
+336666-
336666-
33666888852
 (-33666888852
-33666888852
(33666888852
(-33666888852
((-33666888852
$33666888852
$-33666888852
$(-33666888852
$(/33666888852
#-33666888852
#(-33666888852
#(/33666888852
$(+./336688:::;;;5;
#(+/3366888::::58
#$(++../3366888::::58
$.3368::;;==>>><>
3&3F3Z3
3 3X3d3
343P3l3
3.44484<4@4
3 4,4l4
3;4D4J4
36251,
36251,9<>>
36251,9<>>!
36251,9<4)!
36251,9&7>!
362"%)9<>>!
 /36666-
3666888852
 3666888852
/3666888852
'3666888852
(3666888852
(/3666888852
$((-/3666888852
#$$$(+.+-/3666888852
#$++-/3666888852
(3668::;;===!!<
$-3668::;;===!!<
$./3668::;;===!!<
$./3668::;;==>><4>
$.3668::;;==>><4>
#+/3668:;;=>=>><=4
$/3668::;;;;;<79
$+/3668::;;;;;<79
+3668::;;;;;<79
 -36688:::;;;5;
(/36688:::;;;5;
*36688:::;;;5;
#+/36688:::;;;5;
 -366888::::58
-366888::::58
./366888::::58
'366888::::58
$/366888::::58
$./366888::::58
*366888::::58
#-366888::::58
#+/366888::::58
#366888::::58
+/366888::::58
 -368::;;==>>><>
-368::;;===!!<
/368:,
/368::;===
/368::;==>!
/368::!
#368::;;===!!<
/368::;4
(368:;;=>=>><=4
(368::;;==>><4>
$/368::;;==>><4>
/368::;=7
/368::;==>!7<=4
/368::;==>!7<>7
/368::;==>!77%4
'368::;;;;;<79
*368::;;;;;<79
-3688,
-36882;==
-36882;=>=
-36882;;
-36882;=>=4!%)
-36882;=>=4)>)
-36882;=>=4)>4
(36882;=>=4)>4
-368825
+3688:::;;;5;
 /36888::::58
-36888::::58
'36888::::58
(36888::::58
36888::::58
&3[7z7
383?3G3L3P3T3}3
383D3d3p3
393?3L3T3o3
394X4]4g4s4}4
;3<A<w<
3blOJ>
?3!C9(G=+A6$i`R
3C?\ZB
3F3J3N3R3V3Z3^3b3f3j3n3r3v3z3~3
=!=%=,=3=>=H=L=S=\=c=g=m=q=
3http://csc3-2009-2-aia.verisign.com/CSC3-2009-2.cer0
3http://csc3-2009-2-crl.verisign.com/CSC3-2009-2.crl0D
>'>3>L>m>v>
3nfZ^R7
?#?)?3?:?N?U?[?i?p?u?~?
3P3\3c3p3|3
3P?T?d?h?p?
3qEn-@
-:;;=>=>><=4
;==>><4>
:;==>><4>
!;=>><4>
)<>><=4
*:;;==>><4>
&=>><4>
&;>=>><=4
%==>><=4
404<4D4\4d4l4t4|4
40595e5k5t5{5v6+757V7b7
4.0 Client Profile
4.0 Full Profile
414?4E4g4z4
4,4044484@4X4h4l4p4x4
4#4(4.434B4X4^4f4k4s4x4
4 4$4(4,4044484<4@4D4H4L4P4T4X4,?0?
4 4$4(4,4044484<4@4D4H4L4P4T4X4\4`4d4h4l4p4t4x4|4
444444
4$4,484X4`4h4t4
4'4.4f4k4x4
4)4.4J4l4w4
4-4<4L4`4}4
4>4^4u4
4<4A4/5l5v5
4.4f4s4}4
4(4H4h4
4<4H4h4t4
4!4O4V4h4q4
4@5F5`5
4	5U5`5f5
46<6D6L6T6\6d6l6t6|6
4=6O6\6h6r6z6
47AJ<)=
49bzFz
4 Ab*O
=$=,=4=<=D=L=T=`=
<$<,<4<<<D<L<T<\<d<l<t<|<
;$;,;4;<;D;L;T;\;d;l;t;|;
:$:,:4:<:D:L:T:\:d:l:t:|:
>,>4><>D>P>p>x>
4E5M5T5X5a5j5p5}5
;4;:;?;`;e;l;q;x;
?4?@?`?h?p?x?
?$?(?,?4?H?P?X?`?d?h?p?
4http://secure.globalsign.com/cacert/gscodesigng2.crt0
;$;4;I;
;.;4;I;i;
?&?/?4?K?R?]?b?i?r?
<(<4<L<P<l<p<
'}4l)w>
4M5Z5q5
4ME3G>2C:)@7&>5$=3"=3"<3"1'
4ne[tkUshRo`E
]4SSSh8
=(=4=T=p=
4Z0fq3
<	=$=5=
*:;;5;
5:;===!!<
5:;==>>><>
5:;;===!!<
505:5R5o5
506N6c6
"52;=>=4)>4
5;=>=>><=4
5:;=>=>><=4
5*515:5i5p5~5
5*515B5Y5
5&525>5H5T5`5l5x5
?5$?5$>4#>4#=4#=3"=4#=3"<2!G?.ZRC=5&:1":2":2":2":1":1":1":1"90"90"90"8/"8/!8/!8/!7. 7. 7. 7-
5 5(50585D5d5l5t5|5
5!5*535@5U5a5x5
5 5,545L5X5x5
5#5-545Q5z5
5%5-555L5e5
5 5$5<5@5P5t5
5(5,5<5@5P5T5d5h5x5|5
5+5]5d5h5l5p5t5x5|5
5@5d5p5x5
5^5e5x5
5$5H5Q8
5$5H5t5
5:5U5x5
5.5y8i9
5;=>!7<>7
5:;==>!7<>7
5&787R7
5:;;;;<79
5!8+8H8S8
59<<>>
~5csk8J
5Digital ID Class 3 - Microsoft Software Validation v21
5g6o6u6
5K6Q6b6x6
5L8P8T8X8\8t8x8|8
: ;+;5;N;X;k;
5P5?7E7
>">5>Y>
,6::;;===!!<
*6::;;==>>><>
606;6_6i6v6
6330.....0000(.
639`9{9
:63(%#h`[
%6::;;==>><4>
@6$>4"8,
6:::;;;5;
&,)66"
6 60646D6H6L6P6T6X6\6`6d6h6l6t6
6!616c6j6t6
-6630.....0000000+.
-66333/0//--
6'636@6d6v6
6&636Q6[6d6o6
&,)666*
6- 6- 6-
6$6,646<6D6L6T6\6d6l6t6|6
&,)6666*
6%6*6;6
-6666333/0//--
-6666626
-66666333/0//--
66666333/0//--
-66666,&6
&,)666666
666666,126"
&,)6666662
,6666662,&5
%66666630.....0000(.
6666666,126"
6666666333/0//--
-6666666,&6
&,)66666666
&,)666666661"26666666,&6
6666666626
-6666666630.....0000(.
&,)666666666
,666666666,126"
&,)6666666662
-666666666626
66666666662,6
&,)6666666666%%266666,&6
*6666666666333/0//--
,6666666666,&6
&,)66666666666
&,)666666666662
'6666666666626
&,)666666666666, 1666,&6
*666666666666333/0//--
&,)6666666666666'
666666666666,&6
,666666666666626
&,)66666666666666,
6666666666666,&6
-6666666666666626
	""*66666666666666333/0//--
66666666666666,&6
&,)6666666666666661
6666666666666662,6
'666666666666666,&6
 666666666666666626
&,)66666" 66666666666,&6
&,)6666666'"666666666,&6
&,)66666666666666666,
"66666666666666666,&6
&,)666666666666666666,!*
-6666666666666666662,6
&,)666666666666666666,&6
&666666666666666666,&6
6#6)6.6B6X6^6h6y6
666888852
-666888852
/666888852
6$6?6b6
6 6@6L6p6
6(6`6t6
6(6/6U6
+/668:;;=>=>><=4
6$686T6X6t6x6
6%686Z6a6w6}6
#/668::;;;;;<79
-6688:::;;;5;
$/6688:::;;;5;
/66888::::58
$/66888::::58
6 6I6o6
/6::;==>!7<>7
6$7.7:7F7R7]7
6!7.7A7G7^7j7p7|7
6|7,8O8
*6::;;;;;<79
6::;;;;;<79
6$7T7r7
-68::;;==>>><>
*68::;;===!!<
*682;=>=4)>4
*68:;;=>=>><=4
*68::;;==>><4>
*68:::;;;5;
68:::;;;5;
68::::58
$/68::;==>!7<>7
-68::;;;;;<79
*68::;;;;;<79
-688:::;;;5;
,688:::;;;5;
"688:::;;;5;
*688:::;;;5;
688:::;;;5;
-688::::58
688::::58
-6888::::58
/6888::::58
*6888::::58
6888::::58
:!:.:6:B:G:L:S:k:x:
6^bMRQ4q
6C7U7^7
6H7M7_7}7
:6;H;k;r;
:(:6:m:~:
%{6n'<
6$;\[z
:(:7:|:
/,)/,)?:7
7==>>><>
7==4)>4
7=>=4)>4
>7;?__?;7>
;>!7<>7
7 7074787<7@7D7H7L7P7T7\7t7
7+727J7
7+747t8
7=>!7<>7
7 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7
77777777777^
7(777N7R7W7a7k7u7
7 7$7P;H<
7(7H7P7\7|7
7(7H7T7t7
7)8084888<8@8D8H8L8
787g7 8C8N8q8
787X7x7
7]8c8h8n8
7\8d8|8
7+8I8t8
:;;;<79
::;;;<79
&:;;;;;<79
7(91979F9W9
7B1(Bj5
7C8M8V8\8a8{8
7E8N8Z8
<!<,<7<E<k<z<
;7|G;p
7_Hl7i
7_Hz7{
7I7`7j7
>(>->7><>I>N>]>b>n>s>
7j/hdy
7\L!_5
?&?,?7?M?X?o?
?7!Op1
< <&<7<=<O<U<`<s<
7P5fpX
7Richx
7T%@M4
>/>7>?>V>o>
7WQJqfG
7Y{eXAeY@;Vn
=8>[>~>
,8:;;===!!<
,8:;;==>>><>
80 90"2(
819:9F9_9
8/!:2$4,
,8:;;=>=>><=4
841sje
842d]X
842qic
842YRN
%8:::;;;5;
8:;;;5;
8::;;;5;
,8::58
<85WQL
8;==>!7<>7
-8:;;;;;<79
8:;;;;;<79
8,808H8X8\8`8d8l8
88:::58
8 8@8`8
8$8@8`8
8/!8/!8/!8.!7. 7. 7. 7. 6-
8 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8
8$8<8H8h8p8
8'8D8{8
8<8D8L8T8\8d8l8t8|8
8 8D8M8T8]8
8*9\9t9{9
8?9E9M9U9i9r9
8;9I9O9_9d9|9
8?a5T=
>&>8>D>
?$?(?8?<?@?D?L?d?t?x?
=&=/=8=F=]=o=
?8?F?T?[?
8Kf:8Jfv@
8niCZT
)8;Pxs2
8Q9\9v9
'?8>;R4[pp4)ioF
8VVVVV
]9+ /[
9=>>><>
90 80 80 80!7. :1#XPCIA36-
9&:0:H:O:Y:a:n:u:
90u'AA
9=>=>><=4
9=4)>4
949:9d9
9&:5:]:e:
=96JEA
=96WQL
9!7<>7
97D0C592C4E374E0066096B1677136A056B0B59264520433040497D0C402C4320412550366F0D790C7D117C39543B592050597D0D5F204431523640197B0F7A0B670A4F224D2F5626297D0F5A3B5F3960027603721E73365B34562F5F597D0A4F2B5817791D68007400583A4F2E4A2A297D0E5B3F4C036D097C1460144C2E5B3A5E3E3
989H9P9d9l9p9t9|9
',!99<<>>
99<<>>
9$909P9X9`9h9p9x9
9-92999K9_9z9
9$9,989X9d9
9 9)9b9
9)9]9c9
9$9)9H9O9r9
9'9?9Q9u9
9:9F9M9_9f9w9
9(9H9h9p9x9
)+9;;>C+
9$:C:b:
9`?d?h?l?p?t?x?|?
9DY.Af
9':-:F:L:
9j:o:x:
9l:)=@=
9/:L:i:
9ne2>5-@7*B8(@6&>4#<2"90 90 90 5+
;9PSJ/.-G@9;
__]9PST>C`
9T9^9i9
]\_9]Tt	
9v:F=]=
9VrjX9?Vj
A0DB34FC6FE35D429A28ADDE5467D4D7
a-+%444
A6$C9(8.
A;>8?+
AAFFf;
@@AAJu
abcdefghijklmnopqrstuvwxyz
ABCDEFGHIJKLMNOPQRSTUVWXYZ
=;=A=b=h=
AdH5k"A1o"
AdjustTokenPrivileges
ADVAPI32
ADVAPI32.dll
:A:e;m<
AFIEBi_
Ah^LndIndIndGi`Gf]I
;#;A;I;
#aiMcWI
;?;a;J=
AL*d`om
AllocateAndInitializeSid
:A:L:R:b:g:x:
america
american
american english
american-english
An application has made an attempt to load the C runtime library incorrectly.
AN#;	n
a*Nz'Bg:
AppendMenuW
Arg list too long
ASbcW?]VEXQFznD
ASK/u(
</assembly>PAPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADD
<assembly xmlns="urn:schemas-microsoft-com:asm.v1" manifestVersion="1.0">
<assembly xmlns="urn:schemas-microsoft-com:asm.v1" manifestVersion="1.0"><trustInfo xmlns="urn:schemas-microsoft-com:asm.v3"><security><requestedPrivileges><requestedExecutionLevel level="asInvoker" uiAccess="false"></requestedExecutionLevel></requestedPrivileges></security></trustInfo><application xmlns="urn:schemas-microsoft-com:asm.v3"><windowsSettings><ms_windowsSettings:dpiAware xmlns:ms_windowsSettings="http://schemas.microsoft.com/SMI/2005/WindowsSettings" xmlns="http://schemas.microsoft.com/SMI/2005/WindowsSettings">true</ms_windowsSettings:dpiAware></windowsSettings></application></assembly>P
ATacX@^WEYSE|rH
a`TDg\Dg[CfZBaV?ynV
- Attempt to initialize the CRT more than once.
- Attempt to use MSIL code from this assembly during native code initialization
AUaeYA`YFZTE~sK
.?AUctype_base@std@@
August
australian
.?AVbad_alloc@std@@
.?AVbad_cast@std@@
.?AVbad_exception@std@@
.?AV?$basic_iostream@_WU?$char_traits@_W@std@@@std@@
.?AV?$basic_ios@_WU?$char_traits@_W@std@@@std@@
.?AV?$basic_istream@_WU?$char_traits@_W@std@@@std@@
.?AV?$basic_ostream@_WU?$char_traits@_W@std@@@std@@
.?AV?$basic_streambuf@_WU?$char_traits@_W@std@@@std@@
.?AV?$basic_stringbuf@_WU?$char_traits@_W@std@@V?$allocator@_W@2@@std@@
.?AV?$basic_stringstream@_WU?$char_traits@_W@std@@V?$allocator@_W@2@@std@@
.?AVCAtlException@ATL@@
.?AV_com_error@@
.?AVCSid@ATL@@
.?AV?$ctype@_W@std@@
.?AVerror_category@std@@
.?AVexception@std@@
.?AVfacet@locale@std@@
.?AVfailure@ios_base@std@@
.?AV_Generic_error_category@std@@
AVI LIST
.?AVios_base@std@@
.?AV?$_Iosb@H@std@@
.?AV_Iostream_error_category@std@@
AVI Video Stream #1
.?AVlength_error@std@@
.?AV_Locimp@locale@std@@
.?AVlogic_error@std@@
.?AV?$num_get@_WV?$istreambuf_iterator@_WU?$char_traits@_W@std@@@std@@@std@@
.?AV?$numpunct@_W@std@@
.?AVout_of_range@std@@
.?AVruntime_error@std@@
aV;sJ_}BS
.?AV_System_error_category@std@@
.?AVsystem_error@std@@
.?AVtype_info@@
`aWe[Ec]Kc]Kd[Gb\KAc
:A:Y:w:
aZGd[EfY@F\m
"<)&]B(
B1=7sfy*
B8'A7'A7&A7&A7&A7&A7&@7&?7&>4#;2 ?5$>5$>5$>5$>5#>4#=4#=4#<4"<3#<3#<3$;2#;2#:2":1":1":1"90"90"90"8/!8/!8/!8/!8.!8.!7. 6-
Bad address
bad allocation
bad cast
bad exception
Bad file descriptor
bad locale name
 Base Class Array'
 Base Class Descriptor at (
__based(
===`BBB
:&Bb:Q
.bD$$Y
BeginPaint
belgian
Belize1
Belize city1
Belize City1
be[NncMmcLmbLmbLoeO
<!=(=:=B=G=h=m=
>(>.><>B>H>{>
.%	B"J
Bj?h(w
bnsl_E1z
bqeCh[DeV9
B^R@cW?cW;l^Al]Bl]Al\Al]Al]BiX;cR4bT9cW>cV>bU<iZ?m]Cm\CfW>cU>cW>cV>cT=k\Bl]Bk\AbU<bV=bU;j[@k\Bk\Bj\Bj\Bj\BhY>bQ4l_Cg\C`T<aV<aT;fY>gZ?gY>dW;_R8`T<`T<`S;bV;dV=cU<_R:_S;_S;^R:]P:aTEbVHaUG[O:\P9\O9\O9\O9ZN8^S<
Br	iO&
britain
Broken pipe
Bt?HHt7
>;B Um`
b<>U#q
 bUz%Q#
bV!f$M
.bVN~PZ
bW<XRG[RB
bXGG<(F:'mcS
^bXKk`Jk`JlaKj_JqfR
,ByK2b"3,
BYL<`S<^P8UF.VG.XI0^Q9VH/SE,TF-UG.UG.UG.WI1XI2SF,SF,SF,TF-TG.UH/ZM4_S:^R9^R9]Q9]P8UH0XK3VI/]Q9]Q9]Q:[N6SF,UG.XL3^R:^R:WJ2TH/UH/SF-\O7\O7\P8YM4SF.QD,SE.WK2[N7[N7[O8[N8[N8[N8[N8YL6YL6WK5XL6YL6YL6YL6WL5WK5VJ4OC1NA3MB2QE2VJ4UI3UI3TI4TH3TH3SH3SH3RG2RG2QF2PF1PE1PE1PE0PE0OD0OD0QF3OD0NB/MB.MB.
> >'>;>B>Z>f>l>x>
|BZnQR
;,;c;};
C;\$$|
C;.<4&3+
C7!D8#e[J
C7%H=*B6#ri[
C7$I>+C7%jaR
C8&>3 ogY
CallWindowProcW
canadian
__cdecl
~Cf\Jj_Gh]Eg\D
CFo~(DP
CharLowerW
CharNextA
CharNextW
CharPrevW
CharUpperW
CheckDlgButton
checkNETFrameworkInstalled
CheckTokenMembership
chinese
chinese-hongkong
chinese-simplified
chinese-singapore
chinese-traditional
CHPjPV
:=<C<I<P=_=
)C]Jef
C&kFoO
:):C:\:l:{:
Class3CA2048-1-550
.Class 3 Public Primary Certification Authority0
 Class Hierarchy Descriptor'
clok^Ck`JcZG
CloseClipboard
CloseGadget
CloseHandle
CLPjQV
__clrcall
CLSIDFromString
cNXlkx
CoCreateInstance
CoInitialize
CombineRgn
COMCTL32.dll
COMDLG32.dll
CommandLineToArgvW
CommDlgExtendedError
CompareFileTime
CompareStringW
 Complete Object Locator'
CONOUT$
ConvertSidToStringSidW
ConvertStringSecurityDescriptorToSecurityDescriptorW
`copy constructor closure'
CopyFileW
Copyright (c) 1992-2004 by P.J. Plauger, licensed by Dinkumware, Ltd. ALL RIGHTS RESERVED.
CopySid
CorExitProcess
CoTaskMemFree
CoUninitialize
C PjPV
C$PjQV
C.PjRV
C/PjSV
C*PjTV
C+PjUV
C,PjVV
C-PjWV
CreateBrushIndirect
CreateCompatibleDC
CreateDialogParamW
CreateDirectoryW
CreateEventA
CreateEventW
CreateFileA
CreateFileW
CreateFontIndirectW
CreateMutexA
CreatePopupMenu
CreateProcessAsUserW
CreateProcessW
CreateProcessWithTokenW
CreateRectRgn
CreateThread
CreateToolhelp32Snapshot
CreateWindowExW
- CRT not initialized
:c-\VF
c$whrX
cW=^VG_XE`XE
C!x0hhsT
cXEPC-MA+shW
CXL:ZM7dWA
CXPItiT
cZHf[BM^h
CZN7UI4VJ4
D: >0S
D$4SV3
D$ &+6Q
/d7<?,;
D$,9-l
@.data
??<<&<%<Db
D:\build\autobuild\e957a850ea619703\downloader\Release\downloader.pdb
%){(dc
D:)D:(D:(D:(D:(D:(D:(C9'C9(C9(C9(B8'B8'B8'B8'B8'@7&?6%?6%?7&?6&?6&?6&>5%>5%=5$=5$=4#=4#=4#=3#<3#;3";2#;2":2":2"92"90"90"
dddd, MMMM dd, yyyy
DDD+++vvv
December
DecodePointer
`default constructor closure'
DefWindowProcW
 delete
 delete[]
DeleteAtom
DeleteCriticalSection
DeleteFileW
DeleteObject
DestroyIcon
DestroyWindow
D$HSVW
dI?%%%%%
dialog
DialogBoxParamW
Directory not empty
DisconnectNamedPipe
Disc Soft Ltd1
Disc Soft Ltd1"0 
DispatchMessageW
}dkkdp
dlll|e
{dlPy#
dltl|g
Domain error
DOMAIN error
<$<,<D<P<p<|<
DrawFocusRect
DrawTextW
D$@SVW
DTI3PB2MA,[P=
DT Soft Ltd0
DT Soft Ltd1>0<
="=^=d=u={=
DuplicateTokenEx
Durbanville1
dutch-belgian
D<-]WI<4&4,
D$ wS%
dX?gZABYk
?!?D?Y?
`dynamic atexit destructor for '
`dynamic initializer for '
>@>E>$?0?I?
E4+E0j
E\9{(}
__eabi
EC80F;*D9(C8&C8&9-
EcccQQQQQQcQO4OQOQQQQQQQQ9
ED><:..
E\+ETj
E\+ETP
E`+EXj
E@=FA>730
E@=f^YB=:
eG"A9g
EH;uTv
`eh vector constructor iterator'
`eh vector copy constructor iterator'
`eh vector destructor iterator'
`eh vector vbase constructor iterator'
`eh vector vbase copy constructor iterator'
El9El|
e[MldV
EmptyClipboard
;%;@;E;M;Z;b;
EnableMenuItem
EnableWindow
EncodePointer
EndDialog
EndPaint
england
english-american
english-aus
english-belize
english-can
english-caribbean
english-ire
english-jamaica
english-nz
english-south africa
english-trinidad y tobago
english-uk
english-us
english-usa
EnterCriticalSection
EnumProcesses
EnumProcessModules
EnumSystemLocalesA
<;<E<N<W<_<d<n<|<
E[P55@bc?
!Ep80h
E:\Projects\dtlite\setup\plugin\SetupHlp\ReleaseUninstaller\UninstHlp.pdb
E:\Projects\DTPro\setup\plugin\HelperProcess\Release\SetupHelper.pdb
es{mdQ,}
ETPSSSSSSSSj
EUOH]WG^WG^WG\UGh^L
EVLfRDE
ew=2`4
EX9{0}
Exec format error
ExitProcess
ExitWindowsEx
ExpandEnvironmentStringsW
|&ExX]
eYu+N][N]
F0Pj.S
!F2EP/@
F<*>3!ogZ
F*3q0p
	F4hP1
F4Pj/S
F]5k.v+8
f~8Jfd
f~8JfRich
F8PjDS
f91uPh
f98t	f9}
__fastcall
f<!D[P4
FDPjGS
FdPjOS
fdZi[Ai^F;q
F<,E;+
February
:	;`;f;e<k<
f::::f
fg8Jfd
FhPj8S
FHPjHS
File exists
Filename too long
File too large
FillRect
FindClose
FindFirstFileW
FindNextFileW
FindResourceExW
FindResourceW
FindWindowExW
finpr@disc-soft.com0
F;&K@,E:%tl\
FK;%+%Sbd#
- floating point support not loaded
FlPj9S
FLPjIS
FlsAlloc
FlsFree
FlsGetValue
FlsSetValue
FlushFileBuffers
Fn8x9]e
	fod =
F<PjES
F@PjFS
F\PjMS
F`PjNS
F|Pj=S
F Pj*S
F,Pj-S
F(Pj,S
F$Pj+Sj
F\=pk@
FPPjJS
FpPj:S
fq8Jfd
<FqN-7
FreeEnvironmentStringsW
FreeLibrary
FreeSid
french-belgian
french-canadian
french-luxembourg
french-swiss
Friday
`"f>*S
>$><>F>T>_>d>k>r>
FTPjKS
FtPj;S
>%>F?U?
^F<-uB
Function not implemented
F`vgX="h
fW9t{yW
Fx139O
:):F:X:g:z:
FXPjLS
FxPj<S
FYM5SF4I=&
Fz8a%L'
fz8Jfd
fZ=_XHaYFaZG
:&?-?G?
:";G;*=&?*?.?2?6?:?>?B?z?
GAIsProcessorFeaturePresent
GB?ZSO
GC>;.:=
>?>G>c>p>
gdb~~s
|GDD><33..
GDI32.dll
G/eC~>&
generic
german-austrian
german-lichtenstein
german-luxembourg
german-swiss
GetAccountLink
GetACP
GetActiveWindow
GetBuyNowLink
GetClassInfoW
GetClientRect
GetClipboardData
GetCommandLineA
GetCommandLineW
GetConsoleCP
GetConsoleMode
GetConsoleOutputCP
GetCPInfo
GetCurrentDirectoryW
GetCurrentProcess
GetCurrentProcessId
GetCurrentThread
GetCurrentThreadId
GetDeviceCaps
GetDIBits
GetDiskFreeSpaceExW
GetDiskFreeSpaceW
GetDlgCtrlID
GetDlgItem
GetDlgItemTextW
GetDTEngine
GetEnvironmentStringsW
GetEnvironmentVariableW
GetExitCodeProcess
GetFileAttributesW
GetFileSize
GetFileType
GetFileVersionInfoSizeW
GetFileVersionInfoW
GetFinishStr
GetFullPathNameW
GetLastActivePopup
GetLastError
GetLengthSid
GetLocaleInfoA
GetLocaleInfoW
GetMessagePos
GetMessageW
GetModuleBaseNameW
GetModuleFileNameA
GetModuleFileNameW
GetModuleHandleA
GetModuleHandleW
GetObjectW
GetOEMCP
GetOpenFileNameW
GetOSInfo
GetParamStr
GetPrivateProfileIntW
GetPrivateProfileStringW
GetProcAddress
GetProcessHeap
GetProcessWindowStation
GetSaveFileNameW
GetSecurityDescriptorSacl
GetShellWindow
GetShortPathNameW
GetSidLengthRequired
GetSidSubAuthority
GetStartupInfoA
GetStartupInfoW
GetStdHandle
GetStr
GetStringTypeA
GetStringTypeW
GetSysColor
GetSystemDirectoryW
GetSystemMenu
GetSystemMetrics
GetSystemTimeAsFileTime
GetTempFileNameW
GetTempPathW
GetTickCount
GetTokenInformation
GetTraceEnableFlags
GetTraceEnableLevel
GetTraceLoggerHandle
GetUserDefaultLCID
GetUserDefaultUILanguage
GetUserObjectInformationA
GetUserObjectInformationW
GetVersion
GetVersionExW
GetWindowLongW
GetWindowRect
GetWindowsDirectoryW
GetWindowTextW
GetWindowThreadProcessId
Global\
GlobalAddAtomW
GlobalAlloc
GlobalFree
GlobalLock
GlobalSign CodeSigning CA - G2
GlobalSign CodeSigning CA - G20
GlobalSign nv-sa1
GlobalSign nv-sa1'0%
GlobalSign Root CA0
GlobalSize
GlobalUnlock
G;&OD0OD0OD0OC.NC.NC.NB.MB.MB/MB/MB.LB.LA.LA.LA.K@-K@.J?-MC1MC1I>,J?-I>,I>,I>,G=+G=*G=*G=*G<*G<*F;)F;*E;)E;)D:(D:(D:(C9(C9(C9(
g^Q@6%jaU
great britain
GSYaWB]VEYSGpeB
GU[@Uf
GXbfZA`YF_YJ
gZAwp`x
`h````
<%=?=H=
>?>H>\>}>
h1o2r#@
H9"h\I
haQh[@Jn
hbPgdS^
+=hc rp
HDC{yy
hdrlavih8
HeapAlloc
HeapCreate
HeapDestroy
HeapFree
HeapReAlloc
HeapSetInformation
HeapSize
HG[YC@@?Q[GH
hhd@<'
`h`hhh
H=+H=+I>+G=+F<*G<*G<*F<*G<*F;)F;)E;)E;)D:)D:)D:(C9(J@/KB0C9'C9'C9'C9'B8'@8'@8&@7%@7&A7&@6%?6%?6%>5$>5$>5$>5$>5$=4#=4#;3#
HHMF.R
HH:mm:ss
HHtXHHt
HHu2j@X3
hLhPK<
\hlj]Ch^IaXG
<+<H<M<\<
* h$\<N
holland
hong-kong
Ht{HtL
-http://crl.globalsign.com/gs/gscodesigng2.crl0P
"http://crl.globalsign.net/root.crl0
.http://crl.thawte.com/ThawteTimestampingCA.crl0
 http://crl.verisign.com/pca3.crl0)
"http://crl.verisign.com/tss-ca.crl0
#http://logo.verisign.com/vslogo.gif0
http://ocsp.thawte.com0
http://ocsp.verisign.com0
http://ocsp.verisign.com0?
http://ocsp.verisign.com01
&https://www.globalsign.com/repository/0	
&https://www.globalsign.com/repository/03
https://www.verisign.com/cps0*
https://www.verisign.com/rpa0
+http://ts-aia.ws.symantec.com/tss-ca-g2.cer0<
+http://ts-crl.ws.symantec.com/tss-ca-g2.crl0(
http://ts-ocsp.ws.symantec.com07
http://www.microsoft.com/download/en/confirmation.aspx?id=17718
http://www.microsoft.com/download/en/confirmation.aspx?id=19
http://www.microsoft.com/download/en/confirmation.aspx?id=21
http://www.microsoft.com/download/en/confirmation.aspx?id=24872
http://www.microsoft.com/download/en/confirmation.aspx?id=26
http://www.microsoft.com/download/en/confirmation.aspx?id=31
http://www.microsoft.com/downloads/info.aspx?na=41&srcfamilyid=0856eacb-4362-4b0d-8edd-aab15c5e04f5&srcdisplaylang=en&u=http%3a%2f%2fdownload.microsoft.com%2fdownload%2f5%2f6%2f7%2f567758a3-759e-473e-bf8f-52154438565a%2fdotnetfx.exe
http://www.microsoft.com/downloads/info.aspx?na=41&srcfamilyid=0a391abd-25c1-4fc0-919f-b21f31ab88b7&srcdisplaylang=en&u=http%3a%2f%2fdownload.microsoft.com%2fdownload%2f9%2f5%2fA%2f95A9616B-7A37-4AF6-BC36-D6EA96C8DAAE%2fdotNetFx40_Full_x86_x64.exe
http://www.microsoft.com/downloads/info.aspx?na=41&srcfamilyid=10cc340b-f857-4a14-83f5-25634c3bf043&srcdisplaylang=en&u=http%3a%2f%2fdownload.microsoft.com%2fdownload%2f4%2fd%2fa%2f4da3a5fa-ee6a-42b8-8bfa-ea5c4a458a7d%2fdotnetfx3setup.exe
http://www.microsoft.com/downloads/info.aspx?na=41&srcfamilyid=262d25e3-f589-4842-8157-034d1e7cf3a3&srcdisplaylang=en&u=http%3a%2f%2fdownload.microsoft.com%2fdownload%2fa%2fa%2fc%2faac39226-8825-44ce-90e3-bf8203e74006%2fdotnetfx.exe
http://www.microsoft.com/downloads/info.aspx?na=41&srcfamilyid=333325fd-ae52-4e35-b531-508d977d32a6&srcdisplaylang=en&u=http%3a%2f%2fdownload.microsoft.com%2fdownload%2f7%2f0%2f3%2f703455ee-a747-4cc8-bd3e-98a615c3aedb%2fdotNetFx35setup.exe
http://www.microsoft.com/downloads/info.aspx?na=41&srcfamilyid=5765d7a8-7722-4888-a970-ac39b33fd8ab&srcdisplaylang=en&u=http%3a%2f%2fdownload.microsoft.com%2fdownload%2f7%2fB%2f6%2f7B629E05-399A-4A92-B5BC-484C74B5124B%2fdotNetFx40_Client_setup.exe
http://www.microsoft.com/downloads/info.aspx?na=41&srcfamilyid=9cfb2d51-5ff4-4491-b0e5-b386f32c0992&srcdisplaylang=en&u=http%3a%2f%2fdownload.microsoft.com%2fdownload%2f1%2fB%2fE%2f1BE39E79-7E39-46A3-96FF-047F95396215%2fdotNetFx40_Full_setup.exe
http://www.microsoft.com/downloads/info.aspx?na=41&srcfamilyid=e5ad0459-cbcc-4b4f-97b6-fb17111cf544&srcdisplaylang=en&u=http%3a%2f%2fdownload.microsoft.com%2fdownload%2f5%2f6%2f2%2f562A10F9-C9F4-4313-A044-9C94E0A8FAC8%2fdotNetFx40_Client_x86_x64.exe
http://www.yandex.ru0
;h`UaV
$hUIu[
h>v`bf
hX:bns
_hypot
hyrk|uezsbwp^tn]rlYoiWngUleSjcPj]C]{
i	-0,5
i@5W!1
I#6n',
i[Asm\3
icRgZ?^mwO
I>+D8&E:'>3
@@@@@@@@@@@@idx1@
>If90t
@igcP5
i\hllh\h
\Ih<zm
][iime@,li[]
Illegal byte sequence
	image/gif0!0
ImageList_AddMasked
ImageList_Create
ImageList_Destroy
Improper link
Inappropriate I/O control operation
initDialog
InitializeCriticalSection
InitializeCriticalSectionAndSpinCount
InitializeSecurityDescriptor
InitializeSid
InitLang
Input/output error
install
Install
InstallOptions.dll
InstallSuccess
Instu`
Int64Op
InterlockedCompareExchange
InterlockedDecrement
InterlockedExchange
InterlockedIncrement
Interrupted function call
Invalid argument
InvalidateRect
invalid map/set<T> iterator
Invalid seek
invalid string position
;;>I>O>i>n>}>
ios_base::badbit set
ios_base::eofbit set
ios_base::failbit set
iostream
iostream stream error
Iot]cG\
iO}XR:
? ?%?*?:?i?o?z?
>I?P?r?y?
iqsm_EmbLf[I
<)<I<r<
i[:[RC
irish-english
irshX;htzd
?I?_?s?
Is a directory
IsAdmin
IsDebuggerPresent
IsDialogMessageW
IsNeedGadget
I[SOaXLh]L
IsProcessorFeaturePresent
IsValidCodePage
IsValidLocale
IsValidSid
i[>{s`w
IsWindow
IsWindowEnabled
IsWindowVisible
IsWow64Process
italian-swiss
>!>I>T>Z>`>h>p>v>
`Iu2Bx
iV6kW6m
iX;hsv
!>Ixj\
<<=I=y=
=J~^:#
[j0Xjxf
j8+[T[
JanFebMarAprMayJunJulAugSepOctNovDec
January
jaPE;'KA-KA-LA-K@-K?-J?-J?-J?-J?-I>,I>,I>,H>+H>*G=*H=+F<*[SA_WFF;*E;)E;)E;)E:(D;(D:(D9(D:)D:(C9'B9'B9(@8'A8'A8'@7&@7'?7&?7&?6%
JcEG.k
!je#3q
JEHK__KHEJ
JG\T5DddB%;XGJ
ji^bU9cW>^R;|pQ
JJJ...SSS
j@j ^V
:':J:m:
JN#uL;t
J>)OC/H='vn^
j`OjbLkcLlcL
"Jokkkkkkh6
: :j:p:t:x:|:
j\=<|S
jSOFTWARE\Microsoft\Windows NT\CurrentVersion
j"^SSSSS
<-<J<U<>?
jwB}l9
j\Xjtf
}jyqikdr
=]{jY;SXU
:K@0LB/LA-B6!
KA1e\P
:kB<(#
KERNEL32
Kernel32.DLL
KERNEL32.dll
;$;.;K;\;f;
KFJHS++,521
kJF`|(C?
^kkjhhjjG=
KKj\Xf
kkkkihi(p
k`LOB+WJ4XK5WJ4WJ4WK5WK5VJ4VJ4VI4UI4UI4TI4TI3UH3UH3TH3RG2RG2RG2RG2QF1QF1QF2QF2PE1PE1PE1OD0OD0OD0NC/MB.MB/LA.LA.LA.KA.K@.J?-J?-I?-I?,H>,
kOxR8xR8xR8xR8xR8xR8xR8xR8xR8xR8xR8xR8xR8
:+;K;Q;
kSHCreateShellItem
kSnG1	
KTQGl_
k\@}uby
KUTQHhh
kXHAm9"
KYRIa[Ga[Hb[G`XGkaN
Kzg5>}L
L$<^[3
[l=>:52
[l76./0
l^Bd]HgZ@Ym}
l^Bl`Hi[A
LC_ALL
LC_COLLATE
LC_CTYPE
LCMapStringA
LCMapStringW
LC_MONETARY
LC_NUMERIC
LC_TIME
LeaveCriticalSection
l_Fg^Jh\C^q
list<T> too long
;(;L;l;
[lldgfc?+*)ll[
\llldw
[[[lllooolll[[[
lo1+au
LoadBitmapW
LoadCursorW
LoadIconW
LoadImageW
LoadLibraryA
LoadLibraryExW
LoadLibraryW
LoadResource
LoadRTFToReachEdit
LoadStringW
LocalAlloc
LocalFree
`local static guard'
`local static thread guard'
`local vftable'
`local vftable constructor closure'
LockResource
Lo/obo
LookupPrivilegeValueW
lQN(x1.
LRSOl]
lstrcatA
lstrcatW
lstrcmpiA
lstrcmpiW
lstrcmpW
lstrcpyA
lstrcpynA
lstrcpynW
lstrcpyW
lstrlenA
lstrlenW
@l`TsgPo`C
%lxvit
lyqyqqqgr
:);M;a;h;n;v;
`managed vector constructor iterator'
`managed vector copy constructor iterator'
`managed vector destructor iterator'
MapDialogRect
map/set<T> too long
MapWindowPoints
m^Bf\Guo]`
MB,G:%
M\eeZBaZFc]M
meQfY>eY@j`Lq
MessageBoxA
MessageBoxIndirectW
MessageBoxW
m`Gi`Ki]Cy
MHJFK0
Microsoft Visual C++ Runtime Library
MM/dd/yy
mmmUUUUUU
Module32FirstW
Module32NextW
Monday
Moscow1
MoveFileExW
MoveFileW
movi00db
MP+M<3
	+MQI6
;-=M=R=Y=u=z=
<m=t=~=
MulDiv
MultiByteToWideChar
|m}zj{whxuevrbso^pl\nk[miYkfUieSfbPeaOeaNd`Pd`Pd`Od_Nc_Pc_Pd_Pd_Pc_Nc_Nc^Oc^Ob]Nb^Ob]Nb]Nb]Nb]N`\Mc_QjgX`\M_[L_[L^[L^[L^[L^ZK^ZK^ZK^ZK]YJ]YJZWHjgW
;>;N;{;
; <+<N<
]N@	-'
NA+L@*
NA+RF1L@*zpa
nb?e]Lf^Ke\H
NB,QF1SG3RG2RG1RF1RF1QF1RF1QE1QF2QF2PE1PD1QD1PD0OD0NC/OC/NC/NC.MB.MC/MB.MA.LA.LA.L@.K@,K@,J@,J?,J>,I>,I>,H>,G=+G=+G=+F<*F<*E;)E;*
.ndata
 new[]
new-zealand
_nextafter
?nf\slVqiUogSmePi]B
n`Gh^Ji\Ck{
?#?N?h?
NHDD@<$! 
NI:V?]
[n~iX;]jp
n_jS	,
nnp[/.2okkjjhhK7
No child processes
No error
No locks available
norwegian
norwegian-bokmal
norwegian-nynorsk
Norwegian-Nynorsk
No space left on device
No such device
No such device or address
No such file or directory
No such process
Not a directory
Not enough space
- not enough space for arguments
- not enough space for environment
- not enough space for locale information
- not enough space for lowio initialization
- not enough space for _onexit/atexit table
- not enough space for stdio initialization
- not enough space for thread data
November
Npi`ulYrjWphUofSmdPi\C
=<=N=\=q={=
NQ1R.pd
=>>NQQ]aakkkjjjiiiijkmmmrrrrrreeeUUU
>*><>N>`>r>
/:!^[N'r
(null)
NullsoftInst
NulluN	E
Nwt4q,
NWzC7eA
nwzm\?lhZc
ny{{{yqyqqihhi@H
obFm`Hrm^g
obGl_D}
OC.TI6RG3MA-NB.MA-K?*
October
OF6@6$D9(B8&;0
o`Fg^Ii[Bev
ok[oiV1
ole32.dll
OLEAUT32.dll
OleInitialize
OleRun
OleUninitialize
oLLLLL
`omni callsig'
OoOn;8
OOO Yandex0
OOO Yandex1>0<
OpenClipboard
OpenProcess
OpenProcessToken
OpenThreadToken
Operation not permitted
operator
oqq>Xbw9+
ORRRRT
OT2r'<
?o>#TnS
ouveeeWWW
ox@_mc
oy|iY:my}b
{o|ylyvhwtgtrdqo`nm^mk\kiZhgXfeUedTfdUdbSdbSecTdbTcaSdbSdbScbSbaSbaSb`Rb`Rb`R`_Q`_Qa`R`_Q`_Q`_Q__Q_^P_^P_^P`^P`^P`^P_]O_]O_]O^\N^[N^\N^\M\[M\[M\ZL\ZL[ZLZYKZYKZYK[YK[YK[XK[YJZXJZXJYWIZWIYWIYWIXWIYWIXVHXVHYVHYVHXUHXUGXUGXUFWTFWUGWTFWTFWTEWTFWTFWTFVSEVSEVSDVSDVSEVSDVRCURCWRDWREWRCWRCWRDVRCVRCWRBWRCWRCVQBVPCVQCVQB
}o|zl|wiyugvrdso`pl^mk\lhYjgXieVfbSdbQdbQdaRd`RdaRd`RcaRb_Pb_Pd_Pc_Pc_Pb_Pb_Pb_Pa^Pa^Oa^Oa]O`]N`]N_]M^\M_]N_\M_\M_\M_\M_\M^[L^[L][L^[L]ZK]ZK]ZK[XIWTFZWI\YK]YJ\YJ\YJ[XI[XI[XI\YJZWIZWIZWHZWHZWHYVGYVGYVGYVGYUFYUGXUFWUFWTFWTFXTFXTFXSEXTEXTEXTEWSDWSDXTEXSDXSDWSDXSDXSDWSDWRCWRCWRCWRCWRCWRCWRCWRCWRCWSBWSBXSBWRCXSCXRBYSB
ozR1ML
P1T1X1\1`1d1h1l1p1t1x1|1
__pascal
PathFileExistsW
P\bdZDeZCHZg
pbHlbKi^B~
pbItjUr
:(:<:P:\:d:|:
PD.XK5RD.xm[
PeekMessageW
Permission denied
phb;74
phN{]e	,6
{PI<,#
!pihU1n
PI&l 	/
`placement delete closure'
`placement delete[] closure'
Please contact the application's support team for more information.
![pmbiF
 \pmmkkK;
\pmmmk4
P~ nYw
P[	oB#qj
portuguese-brazilian
PostMessageW
PostQuitMessage
[ppmo[w
PPPP449
PPPPP4@w
PPPPPP
PPPPPPPP
pr china
pr-china
Process32FirstW
Process32NextW
ProductId
Program: 
<program name unknown>
PSAPI.DLL
@{pSf\IncP
PSPP;C`
pSRich
PSSShD
PSSSSSSh 
PSSSSSSSj
PSVSSS
/):p*T`
pT[[^H
P[TIc\Hd\Hd\HaZGndQ
PtInRect
__ptr64
puerto-rico
\p}uLI
- pure virtual function call
{p}vkungqib
PVSVVV
PVSVVVVW
PWPUQQ
pyxl_CmaKeZF
}p}zo|xkxvhvsfsqcqm_nl]mj[jhYhfWfdUdbSdbSdaRdaRdaRebSdaRdaRc`Rc`Rc`Qb`Qc`Qb_Qb_Qb_Qa^Pa^Pa^Pa^P`^P_^O`^O_]O^]O_]O_]O_\N_\N^\M^\M][M][M][M]ZL\[L]ZL\YK\YK\YK\YK\YK\YK[YK[XJZXI\ZKZXI[XJZWIZWIZWIYVHYVHYVHYVHXUGXUHYVHXUGXUGXUGXUFWTFWTGWTFWTEWTEWTEVSEVSDVSEVSEXSEXSDWRDWRCWRCVRCWRCWRCWRCWRCWQCVQBVQBVQBVQBWRCVQBWRCVQCVRB
Pzsgwodxp^tn\rlYoiWngUleRjcPk^Cb
P[Z^XYQ
P[Z^YX
qa]]ar
qbb)@h
q*d[De^Ke^Jc[H
Q(f]Y\
Qg[.D8+G<*F;(F:(B6#
Q_ggZBd\H]VF
q&i,8>Tng
Qj2htt
qjglLB5Y
Qkkhhh@;"
qP(	;F
QPSPPP
QQSVW3
QQSVWd
QQSVWh
QSSSPSS
QSSSSSSPS
QSUVWh
QueryPerformanceCounter
QuoteStr
>=>Q>W>
r""""";
r""""""""""
<!<,=R=
|R04b7
RaiseException
[!{rD8
`.rdata
.rdata
rdInbLl^D
ReadFile
Read-only file system
RegCloseKey
RegCreateKeyA
RegCreateKeyExA
RegCreateKeyExW
RegDeleteKeyA
RegDeleteKeyExW
RegDeleteKeyW
RegDeleteValueA
RegDeleteValueW
RegEnumKeyW
RegEnumValueW
RegisterClassW
RegisterTraceGuidsW
RegisterWindowMessageW
RegOpenKeyExA
RegOpenKeyExW
RegQueryValueExA
RegQueryValueExW
RegSetValueExA
RegSetValueExW
ReleaseDC
`.reloc
.reloc
@.reloc
RemoveCommonComp
RemoveDirectoryW
RemoveFileAssociations
[Rename]
        <requestedExecutionLevel level="asInvoker" uiAccess="false"></requestedExecutionLevel>
      </requestedPrivileges>
      <requestedPrivileges>
Resource deadlock avoided
Resource device
Resource temporarily unavailable
__restrict
Result too large
RE.VI3PC,
`[Rio\
r+J/AZ
RjN wG
r<lc@n
RLH/,)
rlkkki<u
<*=R=n=
r=NPsw\
;RnRWL
RO'iE9
ro`j[>u
Root CA1
_ro$<x
r||ozymxxiutgsrdpobnn_ml]kj\hgYgfXgfXffXffXffWfeWfeWeeWedVeeWeeWedVedVedVdcUccUdcTcbTcbUcbUbbTbaSbaSaaSa`Sa`Ra`R`_R`_S`_R__Q__Q__Q_^P_^P^^P]]P^]P]]P^\O]\O\\N\[N\ZO\[O\ZN[[M[[M[ZLZZK[ZLZYLZXKYXJYXJYXJYXJXWIXWIXWIXWIWVHWVIVUHWVHVUGVUGVUGVTHUTFUTFVUGVTFUTFUSFUSEUSEUSEVSEURDVRDURDURDURDURDURDTQCTQCTQCTQCTQCTQCTQC
RQQQPW
 !R%  R
  RRich
rrrrrr
rrrrrrrrreee
R%RSa!
RSPSSV
@.rsrc
RtlUnwind
r_#`U)=
runtime error 
Runtime Error!
;';S;(<*?1?
"s3dBI'
s9?Zsv-
SaferCloseLevel
SaferComputeTokenFromLevel
SaferCreateLevel
Saturday
`scalar deleting destructor'
ScreenToClient
/[Sd)bz
SearchPathW
    </security>
    <security>
Seed: %d
SelectObject
SendMessageTimeoutW
SendMessageW
Sepg[Ch[BRer
September
SeqiY=c[IgZALao	s
SetBkColor
SetBkMode
SetClassLongW
SetClipboardData
SetCurrentDirectoryW
SetCursor
SetDlgItemTextW
SetEndOfFile
SetEntriesInAclA
SetEntriesInAclW
SetEnvironmentVariableA
SetEnvironmentVariableW
SetErrorMode
SetEvent
SetFileAttributesW
SetFilePointer
SetFileTime
SetFocus
SetForegroundWindow
SetHandleCount
SetLastError
SetNamedSecurityInfoW
SetSecurityDescriptorDacl
SetSecurityDescriptorSacl
SetStdHandle
SetTextColor
SetTimer
SetTokenInformation
SetUnhandledExceptionFilter
SetWindowLongW
SetWindowPos
SetWindowRgn
SetWindowTextW
}sFpgZsjUrgSpePk]C
sG>0B8'A7'@6%@6%=2 MC3
SHAutoComplete
SHBrowseForFolderW
SHChangeNotify
SHCreateDirectoryExW
SHELL32.dll
ShellExecuteExW
ShellExecuteW
SHFileOperationW
SHFOLDER
SHGetDesktopFolder
SHGetFileInfoW
SHGetFolderPathW
SHGetPathFromIDListW
SHGetSpecialFolderLocation
SHLWAPI
SHLWAPI.dll
ShowWindow
SING error
SizeofResource
Sj0[f;
[_SKdXGbW>bV=`T=`UFgZFugHykHqdF_RBYM;^R:^Q;]Q9]P9\P9
^SLGK%
slovak
|sm$! 
}s^naF
softuW
SOFTWARE\
SOFTWARE\Microsoft\NET Framework Setup\NDP\v1.1.4322
SOFTWARE\Microsoft\NET Framework Setup\NDP\v2.0.50727
SOFTWARE\Microsoft\NET Framework Setup\NDP\v3.0\Setup
SOFTWARE\Microsoft\NET Framework Setup\NDP\v3.5
SOFTWARE\Microsoft\NET Framework Setup\NDP\v4\Client
SOFTWARE\Microsoft\NET Framework Setup\NDP\v4\Full
SOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\AutoplayHandlers\CancelAutoplay
SOFTWARE\Microsoft\Windows\CurrentVersion\Explorer\AutoplayHandlers\CancelAutoplay\CLSID
south africa
south-africa
south korea
south-korea
spanish-argentina
spanish-bolivia
spanish-chile
spanish-colombia
spanish-costa rica
spanish-dominican republic
spanish-ecuador
spanish-el salvador
spanish-guatemala
spanish-honduras
spanish-mexican
spanish-modern
spanish-nicaragua
spanish-panama
spanish-paraguay
spanish-peru
spanish-puerto rico
spanish-uruguay
spanish-venezuela
s~}p|{mywjwugtserpbnn`ml^kk\ihZgfXeeVeeVedVedVedVedVdcUdcUdcUdcUdcUcbTcbTcbTcbTbaSbaSbaSa`Ra`Ra`Ra`R``Ra`R`_Q`_Q`_Q`^P_^P^^P^]P^]P^]P^\O^\O]\O\[N][N]\N]\N\[M\[M\[M[ZL[ZL[YL[YK[YKZYKYYKZXJYXJZXJYWIXWIXVHXWIXWIWVIWVIWVHWUGWUGVUGVUGVTFWTFWTFWTFVTFUTFVTFWSEVSEVSEVSEURDVSEVSEVSEVSEURDURDURDURDVRDUQCVRCUQCUQCVRCVRCVRC
s}}pzzmwxjuuhssfppdpobmm`kk]ii\ii\hi\hi]hi\hi]hh\hh[gh[gh[hh[fgZeg[eg[egZefZdfZdeZdeYdeYeeYddXcdXcdWbdWbcWbcWbcVbcVabVabV`aUaaUaaU``T_`T_`T_`T__S__S^_R^^R]^R^^R]]Q]]Q]]Q]]P\\P\\P\\P[[O[[OZZOZZOZZNZZNYYMYYMYXMYYLXXLXXLXWLWWJXWJWWIWWIWWJWVJWUJWUIWUIVTIVTHVTHVTHUTHUTGUTGUTGUSFUSFTRGTRHTRFTRETREURDSRDSRDURDTQC
sqpbaWXYZ[4578862,
s[S;7|G;w
Ssj<aqY
SSPUC^
^SSSSS
__stdcall
~sTjaP
StrAlloc
`string'
StringFromGUID2
string too long
strlstrh8
|s_UH0ZN7[O7XL4i^G
Sunday
SunMonTueWedThuFriSat
-SuV(T@
SV4A :
<SVj83
SVWj>3
swedish-finland
s,WQGZSFbX>
`>/swT
|s~xoysiuoeqkalf\haW`YRXPMYQJbZGmeCkc?^U:LD6?72?70B:-A9*?6(<3%;0"9/!6-
'(sXs~
Symantec Corporation100.
Symantec Corporation1402
'Symantec Time Stamping Services CA - G2
'Symantec Time Stamping Services CA - G20
+Symantec Time Stamping Services Signer - G30
+Symantec Time Stamping Services Signer - G40
system
System.dll
SystemParametersInfoW
T$09T$
	t1Ht'
T$89T$ t
t$8PRP
T$@9T$4t
'tag'Mj
T-bbbz
TerminateProcess
.text0
tGHt.Ht&
TH4QF1qhW
Thawte1
Thawte Certification1
Thawte Timestamping CA0
t;"|Hhcj
+t HHt
This application has requested the Runtime to terminate it in an unusual way.
__thiscall
This indicates a bug in your application.
This indicates a bug in your application. It is most likely the result of calling an MSIL-compiled (/clr) function from a native constructor or from DllMain.
!This program cannot be run in DOS mode.
Thursday
{:\TH^XHncC
TimeStamp-2048-10
TimeStamp-2048-20
tiWsjVtiTrgQm^C
t	j\Yf
tjZI=(J>)pfU
TK;i(`
< tK<	tG
{tld^^]"##)%$
TLOSS error
TlsAlloc
TlsFree
TlsGetValue
TlsSetValue
Too many links
Too many open files
Too many open files in system
t$(PPP
.t|PVj@
t~}q{{oyylwvitsfqqdoobnn_ll^jj[hhZhhZhhZggYhhZhgZggYggYffXffXffXefXefXfeXeeWeeXddWddWddVddVddVcdVbcUbcTbcUabTabTabTaaTaaT``T``T``T``S``S__R__R^^Q^^Q^^Q^^Q]]Q]]P]\P\\P\\O\\O[[O[[O[[N[[N[ZNZZMZZLZZLZYLYYLYYKYWKYWKYWKYXKXWKWVJWWJXVIWVHWVHWVIWVHVUGVUGVUGVUGVTGUSGVTFVTEVTFVSEUSETSETSDURETRETRETRDTRDSRDTRDTQCTQCTRD
tQ<q2z
tR99u2
TraceEvent
TraceMessage
TraceMessageVa
TrackPopupMenu
TranslateMessage
t*=RCC
trinidad & tobago
  </trustInfo>
  <trustInfo xmlns="urn:schemas-microsoft-com:asm.v3">
TSA1-20
TSA1-30
TSA2048-1-530
TSI`XD`XEWSE
t"SS9]
t"SS9] u
<+t"<-t
<+t(<-t$:
""TT[[bbc
"&&T&T[bc0
Tuesday
tunhY<p];d
;t$,v-
t VV9u
|t}woysktnepjalf]gaWc]S_XN[TJYQFTLBPH=ME:JB7F?2C;0@8,=4(:2&8/#6- 3*
t+WWVPV
txsmaFpfQM}
tyHtcHtSHt<Ht
tylqkd}
 Type Descriptor'
`typeof'
TYWdZE`ZJd[FKW\
tz}rw{ouyntwlrvjoshnrgnrgmrfmqemqfmqflqflqemqelpekpdkpdkodjodkocjncjncjnbimbimbhlahlahlagk`gk`gk`fj_fj_ej_ei^ei^dh]dh]dh]dh]cg\cg[cg\bf[aeZaeZaeYadY`dY`dY`cX`cX_bX^cX^aW^aV^`V^`U]_U]_U\^T\^T\^T\]S[]S[\R[]R[\RZ[QZZQZ[QY[PYZPYZOYZPXYOXYNWYNWYNXXMWXLWWLWXLWWKWWKWWLWVLWVKWWKVVJUUJUUJUUJUUIUUITTHTTHTTH
^+#%U`
)#U7;D
u8VVVVj
u[9=46
U@9UTv
|uA<9rjd
^UBC8#[Q>
`udt returning'
\u f9O
ugJoeMnaE
uh8jB$]N
uhEf^Li`JhaJ
!u;;hh7
UiyhY;Wem
uj8h="
u)jAXf;
~}ul^Ch\DgZ?vvly
UmQQc\	
- unable to initialize heap
- unable to open console device
__unaligned
- unexpected heap error
- unexpected multithread lock error
UnhandledExceptionFilter
UNICODE
uninstall
UninstallFinishPageFree
UninstallFinishPageInit
UninstHlp.dll
united-kingdom
united-states
Unknown
Unknown error
Unknown exception
UnpinProgram
UnregisterClassA
UnregisterTraceGuids
un^S"w
'UOHYRF
-UOIi]A
update
UQPXY]Y[
u~~qz{oxzmvwjtuiqrfprdnockmakl`kl`ik_ik_ik_ik_hj_hj^hj^hj^hi]gi]gi]gi]gi]fh\fh\fh\eg[eg[ef[efZdfZdfZceYceZceZceYbdYbdYadWacWacWacV`bV`bV`bV_bU_aU_aU_`T^`T^_T^_S^_S]^R]^R\^R\]Q\]Q\]Q\]Q\]P\\P\\P[[O[ZNZZNZZOYZNYYMYYMYYMXXL\\Q[[OWWKXXLWWKWWKWWJWVKWVKWUJVUIVUIVTIVTIVTIUTHUTHUSHUSHUSHUSHTRGTRFSRFTRFUSETSETSETRD
uR@10B
urlmon.dll
URLOpenBlockingStreamW
URPQQh
USER32.dll
USER32.DLL
u{~sx{pvznswlrujpthmqelpdlpdlpcloclockockocjnbjnbjnbjmajmaimaimailahl`gk`gk`gj_fk_fk_fj_fj_fi^fi^ei]ei]dh]dh]dg\cg]cf\cf[be[ce[beZbdYadY`eYadY`dX`cW`bW`bX`aW`aW_`V^_U]`U]`T]_T^^U]^T\^T\^S\]R\]R[^R[]Q[\Q[\P[\P[\PZ[PYZOYZOYZNYZNXZNXZNXYMXYMWXLXXLXXLWWKWWKWWKWWKWWKVVJVVJVUJVUJUUIUTHUTHUTHTTHUSHTSHSSGTSG
u|~sz|qxymuwlrujrtgoremoclnblnalnakmakmakmajl`il`il`il`il`il`hk_hj_hj^hj^gj^gi^gi]fh]fh]fh]fh]eg[dg[eg[eg[dfZdfZdeZbeZbdYbdYbdYbdXbcXbcXabW`bW`bV`aV`aV_aV_aU^`U^`U^`T]_T]_S\]S\^S\^S\]R\]R\]R\]Q[\P[\PZ[PZ[P[[O[[OZZNZZNZZNZZNYYMYYMYYMYYMXXLXXLXXLWWKVVJVVJVVJVVJVUJVUIUUIVTIVTHVTHUSHUTGUSGUSGTRGTSGTRFTSFTRF
UTF-16LE
uTVWh?
U^UJf]If]If]Id[IqgT
UUUUUUaaa
UUUUUUUUU
UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU
UUUUUUUYYV^_WgiXnqYqtXlnWdeU[\UUUUUU
UUUU[\XlnYy{[
UUVh FF
u`+uX%
+UVa_D
UVJ9^R;^R:^R:^Q:]Q9[O9XL8WK8XL8ZN8ZN8XM6YM7YM7XM7WL6
Uw|Weg
ux7)om
UXXXikZ}
}u~ypztluogrlbng^ibXe^TaZO]VKYRHUOCQK?NG;LD8H@4D<0B:-?6)<4':1$7/"5,
UZ\UUUUUU
:";<;V;
v6SMM[TIcXE
$~V'7"
v7m4l)w&~/u
`vbase destructor'
`vbtable'
`vcall'
Vcig[Bf]I_VF
`vector constructor iterator'
`vector copy constructor iterator'
`vector deleting destructor'
`vector destructor iterator'
vector<T> too long
`vector vbase constructor iterator'
`vector vbase copy constructor iterator'
'VeriSign Class 3 Code Signing 2009-2 CA
'VeriSign Class 3 Code Signing 2009-2 CA0
VeriSign, Inc.1
VeriSign, Inc.1+0)
VeriSign, Inc.1402
VeriSign, Inc.1705
"VeriSign Time Stamping Services CA
"VeriSign Time Stamping Services CA0
+VeriSign Time Stamping Services Signer - G20
VeriSign Trust Network1;09
VerQueryValueW
VERSION.dll
`vftable'
vgiy@(X"
~vgW;}yk
?]VIaYHqeG
vidsDIB 
>VidYC`YHaWA,X
VirtualAlloc
`virtual displacement map'
VirtualFree
VirtualProtect
 Visual C++ CRT: Not enough memory to complete call to strerror.
vj+4wE
vjRh[@j]BsiQ
vj$v	C
vkd^dg_##))))"
vLtiWvjTqbF
VM1lA@
v	N+D$
(VnzyO
}`VO8\b4C
VoE41\<
VolatileTest
}^V\qY
VTH;|pT
VTJbYEcV>*X
:,;V;v;
|v{vpxrltnhoibjd]f`YaZT]VNXQJTMEQJALE=IA8E>4A91?7-:3*70&2) B:1XRG-$
_VVVVV
}v}wqytmuohpjcle_gaZc\U_WP[SKVOFSLAOG=JC8F@4C<2@8.=5*:1&5-"90&>5+/&
V_`YvyL
w]3)rv"C
W7H9o}
W7m(x	
WaitForMultipleObjects
WaitForSingleObject
WaitNamedPipeW
""&W[[[c0
Wc{uz\
Wednesday
Western Cape1
wi>c[Kg^Ig^J
WideCharToMultiByte
WINTRUST.dll
WinVerifyTrust
[^}w#L
w:!LGOdZ
wlWVV?
woi-*(
woi841
wqkrlfmgahc[c^W^YQZUMTPGQKDNG@JB;F>6B:3?7/<4,80'4,$2( .&
^$wqx2
]WR0-*
WriteConsoleA
WriteConsoleW
WriteFile
WritePrivateProfileStringW
|Wrkcvn\tlYrjWohUneRlcPk]Cr
|wrlrmfmgaic]e^X_YR[TNWQHRKDOHAKC<F?7C;4@90=5,92)5/&2+"0(
wr""/p
w(+sei/
wsprintfA
wsprintfW
<W=u={=
w$\UC]VD]VC^WC
WUI_XE^WFbWACT`
{wuolg]""##$"
"""(ww
""&WW[^
www88w
{{wwwqwqqkLJ
{|{wwwrp
^WWWWW
wwwwwwww
wwwwwwwxp
wwx""""""
wwx""""""""""(w
wxr""/p
"""""x
""""""x
"""""""(x
""""""(x
:":.:X:
X[4*)F
	X 9} 
x9;~$}4
XbehZ>Qak
xdll|t
&XF[s	
xg|ueysbvp^tm\qkYoiWngUkeSibPk^DUw
|xg[VH\WI\XI\XI]WH[WH[WH[VG[WHZVG[VG[VG[VG[VG[VGZUFZUFZUFZUFYTEYTEYTEZUFXSDYTEYTEYTEYTEZSDXSC[WHieY^YKXRCXSDXSDXSDXSDYSDYSDXSDXSDYSDYSCYSBYSCYSBYSAZSBYRCZSCZSCZSAZSB
XhllhX
\XJ`XC
Xl;<413
Xl8CbD9('%#
Xli-NilX
x||lleg
xlWYYY?%
XMJYPLZQKXOKiZ<
<?xml version="1.0" encoding="UTF-8" standalone="yes"?><assembly xmlns="urn:schemas-microsoft-com:asm.v1" manifestVersion="1.0"><assemblyIdentity version="1.0.0.0" processorArchitecture="X86" name="Nullsoft.NSIS.exehead" type="win32"/><description>Nullsoft Install System v2.46-Unicode</description><dependency><dependentAssembly><assemblyIdentity type="win32" name="Microsoft.Windows.Common-Controls" version="6.0.0.0" processorArchitecture="X86" publicKeyToken="6595b64144ccf1df" language="*" /></dependentAssembly></dependency><trustInfo xmlns="urn:schemas-microsoft-com:asm.v3"><security><requestedPrivileges><requestedExecutionLevel level="highestAvailable" uiAccess="false"/></requestedPrivileges></security></trustInfo><compatibility xmlns="urn:schemas-microsoft-com:compatibility.v1"><application><supportedOS Id="{35138b9a-5d96-4fbd-8e2d-a2440225f93a}"/><supportedOS Id="{e2011457-1546-43c5-a5fe-008deee3d3f0}"/></application></compatibility></assembly>
XmnV^_
x[P	,#:E_
xp`OC/ul\
xppwpp
xpxxxx
=XQJtiK
xR8xR8
XrgHWK6[N8ZN8YM7YM7XM7WM7XL6WL6WL6VK5WL6]S?VL7TI3TI3TI3
<==X=s=
<xt.<Xu-
<xtX<XtT
`xw	~}
XWJgZ@FT\
}x{wruqmpmhkhcgc]c^Y^YTWRMTNHPJDKE@IC=D>7?82;4.82*3.&0*"-&
}x|xrvrmqmhmichc]c^Y^YSd^YZTOOJDLF@KE?E>9@93<5/92+5.(0*"-&
xxww{wx
XYM9`T<`T<`T<\O8ujS
+y8h5k
y9SS8:
yA]Q@bU<aU<`T<_S;
ygVI2SF/
]yP.dH
yqzumvpiqkcmh_icZd^U`ZP\ULWQGUMCPJ?KF;IB7F>4B:0?7,<3(80%5,"1)
yrDB<<0-
YRG:dYA
YRN_XT
>=Yt1j
yvmhffgj`#'))*)&
{yvon/+%$"
^@Y_%XESs
}y|xswsmrnhmicid]c_Y_YTd_YZUOPKDLG@IC=E?8@;3=7/93,60(2,$/( +%
~y}xsxsmtoiojdie_e`Z`[UZUNUPIQLENHAJE=F@9A;4>80:4,70)3-%0)!,&
~y}ysxtntojokeje_ea[a\V\WPWRKSNGOIBJE=GA9B<5?91;5-81)4.&1*"-&
yyyyyyx
YYYYZV5
+y !`<z
YzpLVJ5WK5PD4PD5OC4TH3VL5VK4VJ4VJ4UJ4UJ3TI3TI3SH2SH2RG2VK7jaOXN;PE0PF2PE1
yZUF\WI\WH\WH\WH\WH[WG\WG[VG[VG[VG[VG[VG[VFZVFZUFZUFZUFZUFZVEZUEZUFYTEZTEYTEYTEYTEYSDZSDZSD\VFe`R]XIYSCYTDYTCYSDYSDYSCZSCZSCYSCZSCZSBZSCZSCZSCZSBZSBZSBZSBZSB[TCZSB
YZWXKJc
>(>:>Z>}>
Z*60]b{Gm
z%Bh`q
^,]zC=9
zcpl	z
zG/E)u
Zhqf\Ed\Id^L1m
zj}wh{uexrbup^sm\pkYniWmgUjdShbPi^GYo
zk}xh|ufxsbvp_tm]qkZoiXmfVkdTibQgaNf_Lj`Ki`Ki`Kh`Kh`Kh^Jg]Gg\De]Ic]Lc\Kc]Ka]Kb]Je[Db[GZ[QU[UWZS^YJeZCc[G`[J`[I`[J`ZH_WE^WD^WD_YH`ZI_YH_YH`XD]UC\TB_WEmgW^XG[TA\TB]VC^XG]WG]WG\WF_WC\T@[SA\T@]WD\VF\VF]VF\UFZRHZRHYRHYRGYQGYQFYQFYQFXQFZUEXQEWPEWPEYSE\UC\TCYSDUNF[R@`U<]T=YQC[TD[TCZTDUPGYQBdX8j]4i]6cW:YPCVPH\UD\VC\UD]VD
zl~xi|ufyscvp`tm]qk[oiYmfVldTibQg`Oe_Me_Le^Le^Le^MvqbkfUb]Kc^Mc^Lb^La^Kb^La]La]Ka\Ka\Kc\Jc\Hc[Hb\J`[J_ZJ_[K_[K_[K`[J`ZJ`ZJ_ZI^YJ^YJ^YI^YI^YH^XH]WGpjXmhV[VG^XH]XG]XF]WG]WG\WG\WG[VF\WF\WF]WE\WF[VEZVEZVEZVFZUFZTEZUEZUDYTEZTEZTEYTDZTEZUDZTDYTDZTDZTDYSCZTB[TCZTCYSEXSEYSDZSDZSCZSBZSBZTCYSCWRDWREWRFXSEZTC[TCZSB[TC[TC[TC
zl~yj|ugxsdvpatn^pl[mjYmgWkeUhcQfaOd`Nd`Nd`Nd`Md`NkgXfbSc]Nc^Nb^Nc^Mb^Mb]Nb]Nb]Nb]Na\La\La\Ma\L`[Lb^NfbS`\L`[K`[L_[L^ZK^ZK^YK^YJ]YJ^ZJ^YJ]XJYUFwtb
ZM8XK4PB*i^J
zo{ukwpfslbha\f^W{tV
zPO/u(x%
zq:0"3)
zr|vmwqhsmcoi_jdZf`Ub[Q^WL[SIUMDOG@KD<JB9I@6G?2D</A8+>6)<3&91#7. 6-
ZSO^XS
zs*'%tkef^Y,)'
zs|vnwrirmdnh_jd[e_Vb[Q^WMZRHUOEQKANF;KC8G?5E=1B9.>6*;2&9/$6,"3+
Z_WJi_Ij_Ij_Jg\IujX
Z{~XmoV^_UVV
zYL4[N7XK4l`L
z}ytwsmuojpkfkf`fa[b]W\WQXSLTNGPJCMF?HB:D=6@:2=6.92*6/'2+#/'
^zz111
^zz1111
^zz1111M
^zz1111MM
zz1111MMM
ZZWVVKKFv
ZZXMk{
ZZZZZ[?